KEGG   Burkholderia ambifaria AMMD: Bamb_2011
Entry
Bamb_2011         CDS       T00398                                 
Name
(GenBank) Conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bam00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bamb_2011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_2011
Secretion system [BR:bam02044]
 Type IV secretion system
  Trb secretion system protein
   Bamb_2011
SSDB
Motif
Pfam: VirB8 DUF4131
Other DBs
NCBI-ProteinID: ABI87567
UniProt: Q0BE56
Position
1:2207295..2207999
AA seq 234 aa
MRFKRPQVRYADTPQPATPYQAAAQVWDERIGSARVQAKNWRLMAFGCLVLALLMAGGLV
WRSAQSIVTPYVIEVDQSGQVRTVGEAATPYRPADAQIAHHLARFVTLVRSLSIDPIVVR
QNWLDAYDYTTDKGAAVLNDYASKNDPFARVGRESVTVQITSVTRASDASFNVRWTEQRF
VNGVPAGTERWNAVLSIVLQTPRTEQRLRKNPLGIYVNGLSWSRELDSSEGAKP
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcgatttaaacgaccgcaggtgcgctatgccgatacgccgcagcctgccaccccatat
caagctgccgcccaagtgtgggacgagcgcatcggctcggcccgcgtacaggcgaagaac
tggcggctgatggcctttggctgcctagtgctggccttgctgatggccggcggcctggtg
tggcgttcggcgcagtccatcgtgacgccctacgtcattgaagtcgatcagtccggccag
gtgcgtaccgtgggcgaagccgctacgccgtaccggcccgccgatgcgcagatcgcgcat
cacctggcgcgcttcgtgacgctggtgcgttcgctgtccatcgaccccatcgtcgtgcgg
cagaactggctcgatgcctatgactacaccaccgacaagggcgcggccgtgctcaacgac
tacgcgagcaagaacgatccgttcgcccgcgtcggccgcgagtcggtgacggtgcagatc
accagcgtcacgcgcgcgagcgatgcctcgttcaacgtccgctggacggagcagcggttc
gtcaatggcgtacccgctggcaccgaacgctggaatgccgtgctttccatcgtcctgcaa
accccgcgtaccgaacagcgcctgcgcaagaacccgctggggatctacgtcaacggcctg
tcgtggagtcgcgaactggattcttccgaaggagccaagccatga

DBGET integrated database retrieval system