KEGG   Burkholderia ambifaria AMMD: Bamb_2013
Entry
Bamb_2013         CDS       T00398                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bam00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bamb_2013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_2013
Secretion system [BR:bam02044]
 Type IV secretion system
  Trb secretion system protein
   Bamb_2013
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABI87569
UniProt: Q0BE54
Position
1:2209003..2210286
AA seq 427 aa
MSQDDTPDLAAPQAAGKIAPEAVALRALPRPVTRLNRRTLAILTGGLSVAVLGALMWSLQ
PQRRGANEQAELYNVDRVSKSEGLDALPADYSKLPSALPPTVPELGPPLPGDLGPAIVKS
QQPVTAAYAAPGNDPNDALRKEAEAAAGSSVFFRSGTQKAAPVAQSQATAAPGFAANAAF
DPMAAGPASTAAQPADLTAVQNRQDQKEAFQKAGTTETRNSGNLALPASPYQVMAGTVIA
GALVTGIKSDLPGDVIATVTEPVYDTATGRFLLIPQGSRILGRYNSQVSYGQSRVQVVWN
RIILPDTSSLTLDNLVGADPAGYAGLEDDVDYHWGRIFAGAALTTLLGVGAELAAPENRQ
DGDRIIIAGRDSAQDSINQVGQELTRRNMNIQPTLTERPGLPVRVIANRDLVLRPYQPLF
FNKGTSR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagccaggacgacactcccgacctcgccgcgccgcaggcggcgggcaagatcgcgccc
gaggcggtggcgctgcgcgccctgccgcgcccggtcacgcgcctgaatcggcgcacgctg
gccatcctcaccggcggcctgtcggtcgccgtactcggcgcgctgatgtggtcgctgcaa
ccacagcggcgcggggccaacgagcaggccgagctttacaacgtggatcgcgtctccaag
tccgaaggattggacgcgctgccggcggattactccaagctgccgtcggccttgccaccc
acggtacccgagctggggccgccgctgccgggcgatcttggcccggccatcgtcaagtcg
cagcagccggtgacggccgcctatgcggcccctggcaacgacccgaacgatgcgctgcgc
aaggaagccgaagcggccgcgggttcatcggtgttctttcgctctggcacgcagaaggcc
gcgccggtggcgcagtcgcaggctaccgccgcgccgggcttcgctgccaatgcggcgttc
gacccgatggcggccgggccagcctccacagcggcgcagcccgccgacctgacggcggta
cagaaccggcaagaccagaaagaggcattccagaaagccggaaccacggaaacccgtaat
tccggcaacctggccctgccggcttcgccgtatcaggtgatggccgggacggtcatcgcc
ggtgcgctggtgacgggcatcaagtcggatttgccgggcgatgtgatcgccacggtgacg
gagccggtctatgacacggccaccgggcgctttctgctgatcccgcagggttcacgcatc
ctgggccgctacaacagccaggtcagctacggacaaagccgcgttcaagtcgtctggaac
cggatcatcctgcccgacacgtcttcgctgacgctcgacaacttggtcggagccgacccg
gctggctatgccgggctggaagatgacgtggactaccactggggccgcatcttcgccggc
gcggcgctgaccacgctgctgggcgtcggcgccgagctggccgcgcccgagaaccgccag
gacggcgaccgcatcatcatcgccgggcgcgacagcgcgcaggacagcatcaaccaggtc
ggccaggagctgacccggcgcaacatgaacatccagccgacgctgaccgagcggccgggc
ctaccggttcgcgtcatcgccaaccgcgacttggtactgcggccctaccagccattgttc
ttcaacaaagggacttcgcgatga

DBGET integrated database retrieval system