KEGG   Burkholderia ambifaria AMMD: Bamb_2463Help
Entry
Bamb_2463         CDS       T00398                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00053  Ascorbate and aldarate metabolism
bam00071  Fatty acid degradation
bam00280  Valine, leucine and isoleucine degradation
bam00310  Lysine degradation
bam00330  Arginine and proline metabolism
bam00340  Histidine metabolism
bam00380  Tryptophan metabolism
bam00410  beta-Alanine metabolism
bam00561  Glycerolipid metabolism
bam00620  Pyruvate metabolism
bam00625  Chloroalkane and chloroalkene degradation
bam00903  Limonene and pinene degradation
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2463
   00053 Ascorbate and aldarate metabolism
    Bamb_2463
   00620 Pyruvate metabolism
    Bamb_2463
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bamb_2463
   00561 Glycerolipid metabolism
    Bamb_2463
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bamb_2463
   00310 Lysine degradation
    Bamb_2463
   00330 Arginine and proline metabolism
    Bamb_2463
   00340 Histidine metabolism
    Bamb_2463
   00380 Tryptophan metabolism
    Bamb_2463
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bamb_2463
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bamb_2463
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bamb_2463
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bamb_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF742 DUF1487
Motif
Other DBs
NCBI-ProteinID: ABI88019
UniProt: Q0BCV4
Position
1:2712150..2713589
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGEWTLPAQLETIPVVDPSDGQPFATIARGTAPDIERAVAAAREAFVGPWGA
ASAAERGRVLMRLSARVADHLEELATIEARDTGKPLKQARADAAALVRYFEFYAGAADKL
HGETLPYQAGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACL
SVLRVAELAAEAGLPAGALNIVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAAE
NHVPVTLELGGKSPQIVFADADLEAALPVLVSAIVQNGGQTCSAGSRVLIEHAVYEPLVD
RLATAFNALRVGPSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAGHGQVVADAPESG
FYQAPALLRDVPASHRLAQEEVFGPVLAAMRFVDEEEAVALANGTPYGLVAGIWTRDGAR
QLRLARRLRAGQVFINNYGAGGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcgggcgaatggacgttgcccgcgcagctggagaca
atcccggtcgtcgatccctccgacggccagccgttcgcgacgatcgcgcgcggcaccgcc
cccgacatcgagcgcgcggtcgccgcggcccgcgaagcgttcgtgggcccgtggggcgcg
gcgagcgccgccgagcgcggccgcgtgctgatgcggctgtcggcgcgcgtcgccgaccat
ctcgaggaactcgcgacgatcgaggcgcgcgacaccggcaagccgctgaagcaggcgcgt
gccgatgccgccgcgctcgtgcgctatttcgagttctacgcgggcgctgccgacaagctg
cacggcgagaccctcccctatcaggccggctatacggtgctgaccgtgcgcgagccgcac
ggcgtcaccggccacatcgtgccgtggaactacccgatgcagatcttcgggcgcagcgtc
ggcgcggcgctcgcggccggcaacgcgtgcgtcgtgaagccggccgaggacgcgtgcctg
tcggtgctgcgcgtcgccgagctggccgccgaagccgggctgccggccggtgcgctcaat
atcgtcaccggctatggccatgaggcgggcgccgcgctcgcgcgccacccgggcatcgac
cacatctcgttcaccggctcgcccgcgaccggcaagctcgtcacgcagatggccgccgag
aaccacgtgcccgtcacgctcgagctcggcggcaagtcgccgcagatcgtgttcgccgac
gccgatctcgaagcggcgctgcccgtgctcgtgtcggcgatcgtgcagaacggcgggcag
acctgctcggccggcagccgcgtgctgatcgagcacgcggtctacgagccgctcgtcgat
cggctcgccaccgcgttcaacgcgctgcgggtcggcccgagccgcgcggatctcgactgc
ggcccgctgatcaacgcgaagcagcagcagcgcgtgtgggatttcctgtccgacgcgcag
catgacggcattccgatggccgggcacggccaggtcgtcgccgacgcgcccgaaagcggc
ttctaccaggcccccgcgctgctgcgcgacgtgccggcgtcgcaccggctcgcgcaggag
gaagtattcggcccggtgctcgccgcgatgcgtttcgtcgacgaggaggaagcggtcgcg
ctcgcgaacggcacgccgtacggcctcgtcgcaggcatctggacccgcgacggcgcgcgc
cagctgcgcctcgcgcggcgcctgcgcgccggtcaggtgttcatcaacaactacggtgcg
ggcggcggcgtcgaactgccgttcggcggcgtcggccattcgggccatggccgcgagaaa
ggcttcgaggcgctgtatggcttcaccgcactgaagacgatcgcgatccggcacggctga

DBGET integrated database retrieval system