KEGG   Burkholderia ambifaria AMMD: Bamb_2861Help
Entry
Bamb_2861         CDS       T00398                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00900  Terpenoid backbone biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bamb_2861
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bamb_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABI88417
UniProt: Q0BBQ6
Position
1:3155435..3156316
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGRVARV
TDVPGVPEESDLVVRAANLLKAHTGTTAGVDIEIDKCLPMGAGLGGGSSDAATTLLALNR
LWQLDLSRTELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEVELPTRWFLVVTPRVHVP
TAEIFSDELLTRNTKPVTIADFLAQQNSDAGWPDSFGRNDMQQVVTSKYAEVAQVVKWLY
NVTPARMTGSGASVFAAFQSKHEAEAAKAQLPTGWNGAVAESLNEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgccttgcgcccgcgaaactcaacctgttc
ctgcacatcaccggccgtcgcccgaacggctatcacgatctgcaaagcgtgttccagttg
ctgaactggggcgacacgctgcacttcacgctgcgcgacgacggtcgcgtcgcccgcgtc
accgacgtgccgggcgtgcccgaggaaagcgatctcgtcgtgcgcgcggccaacctgctg
aaagcgcatacgggcaccacggccggcgtcgacatcgagatcgacaagtgcctgccgatg
ggcgcgggcctcggcggcggcagctccgacgcggcgacgacgctgctcgcgctgaaccgc
ctgtggcagctcgacctgtcgcgcaccgaactgcaatcgctcgcggtaaaactcggcgcc
gacgtcccgttttttgtttttggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtagaattgccgactcgctggttcctggttgtgacgccgcgagttcatgtcccc
accgctgaaattttttcagatgagttgttgacaagaaatacgaagccagtcacaattgct
gactttcttgcacagcaaaacagcgatgcgggatggccagacagtttcggccggaacgat
atgcagcaagttgtgacaagtaagtacgcggaagttgcgcaggtggtcaaatggttgtat
aatgtgacccccgcgaggatgaccggctccggagcaagcgtgtttgcagcgtttcaaagc
aagcacgaggcagaagcggcgaaagcccagctgcccaccggttggaacggtgcagttgcc
gagagcctgaacgagcatccgctcttcgctttcgcgtcatga

DBGET integrated database retrieval system