KEGG   Burkholderia ambifaria AMMD: Bamb_2960Help
Entry
Bamb_2960         CDS       T00398                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00071  Fatty acid degradation
bam00280  Valine, leucine and isoleucine degradation
bam00281  Geraniol degradation
bam00310  Lysine degradation
bam00360  Phenylalanine metabolism
bam00362  Benzoate degradation
bam00380  Tryptophan metabolism
bam00410  beta-Alanine metabolism
bam00627  Aminobenzoate degradation
bam00640  Propanoate metabolism
bam00650  Butanoate metabolism
bam00903  Limonene and pinene degradation
bam00930  Caprolactam degradation
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01212  Fatty acid metabolism
Module
bam_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bamb_2960
   00650 Butanoate metabolism
    Bamb_2960
  Lipid metabolism
   00071 Fatty acid degradation
    Bamb_2960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bamb_2960
   00310 Lysine degradation
    Bamb_2960
   00360 Phenylalanine metabolism
    Bamb_2960
   00380 Tryptophan metabolism
    Bamb_2960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bamb_2960
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bamb_2960
   00281 Geraniol degradation
    Bamb_2960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bamb_2960
   00627 Aminobenzoate degradation
    Bamb_2960
   00930 Caprolactam degradation
    Bamb_2960
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bamb_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: ABI88516
UniProt: Q0BBF7
Position
1:complement(3263236..3264063)
Genome map
AA seq 275 aa AA seqDB search
MADLAAYGGYEALKVTRREHGVLDIVMSGEGANRSGLATANERMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVDAMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLLCEP
VSGEEAERIGLVSLAVESADLLPKAYEVAERLAHGSQSAIRWTKYALNNWLRSAGPTFDT
SLALEFMGFSGPDVQEGIRSLRERRPPDFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcttgccgcatacggcggttacgaagcattgaaggtgacgcgccgcgagcat
ggcgtgctcgatatcgtgatgagcggcgagggcgcgaatcgcagcggcctcgcgaccgcg
aacgaacgcatgcatcgcgaactcgccgacatctggcgcgacgtcgaccgcgatcccgac
acgcgcgtcgcggtgatccgcggcgagggcaagggcttttcggcgggcggcgatctcgcg
ctcgtcgacgcgatggcgaacgacttcgacgtgcgcgcccgcgtgtggcgcgaagcgcgc
gacctcgtctacaacgtgatcaactgcagcaagccgatcgtctccgcgatgcatggcccg
gccgtcggcgcggggctcgtcgccgggctgctcgccgacatctcgatcgccgcgaaggat
gcgcgcatcatcgacggtcatacgcggctcggcgtcgcggccggcgatcatgcggcgatc
gtgtggccgctgctgtgtgggatggcgaaggcgaagtactacctgctgctgtgcgagccg
gtgagcggcgaggaagccgagcggatcggcctcgtgtcgctcgcggtcgagtcggccgac
ctgctgccgaaggcgtacgaagtcgcggagcggctcgcgcacgggtcgcagtcggcgatc
cgctggaccaagtacgcgctgaacaactggctgcgcagcgccgggccgacgttcgatacg
tcgctcgcgctcgaattcatgggcttctcggggcccgacgtgcaggaaggcatccgctcg
ctgcgcgagcggcgcccgcccgacttccccggcgacgcaccgttctga

DBGET integrated database retrieval system