KEGG   Burkholderia ambifaria AMMD: Bamb_3467
Entry
Bamb_3467         CDS       T00398                                 

Definition
(GenBank) ImpA domain protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3467
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3467
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABI89021
UniProt: Q0BA02
Position
2:complement(264557..265660)
AA seq 367 aa
MSKKPSPRQSISGKATAKDTPHHDWLAPVSNAMPCGPDLEYDHDFVVLFTSAAPRQDVQY
GAFVGAPDPVNWSEIERDCQRLMLRTKDIRVAVLYTRSRTRLAGAAGLADGTGLLAAWLD
AFAEQVHPQPDVDGGRDAAREMRMNAIQALADPAGLLADVREIVLSKSTLARLQVRDVER
AFAHPRPADALAPESVTQQLQDVRAQQPEVMAGFDDAITHLAAIDAWCAVHLDGYLPELS
SLTRLLGRLKAPASANAIEQLEESYDPPSAASESSGRDASAPLEPPNDGPVSATERMTAP
PGSAPTDRQAALALIRTARTWFETHEPSSPIPVLLKRAEQFVGKPYAEVVTAIPAELLAQ
WEETESG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagcaaaaagccgtcaccccgacagtccatatccggtaaagctaccgcgaaggacacc
ccgcatcacgactggctcgcgcccgtgagcaacgccatgccctgcggccccgacctcgaa
tatgaccacgatttcgtggtgctgttcacgagtgcggcgcccaggcaggacgtgcagtac
ggcgcattcgtcggtgcccccgatccggtcaactggagcgagatcgaacgcgactgccag
cggctcatgctccgcacgaaggatattcgagtcgctgtgttgtacacgcgaagccgcacg
cggctcgccggtgccgcaggtcttgcagatggcacaggattgctggccgcctggctcgat
gcgtttgccgaacaggtgcatccacagcccgatgtcgacggtgggcgcgacgccgcacgt
gaaatgcggatgaatgcgatacaggcgcttgccgatccggccggactgctcgccgacgtg
cgcgagatcgtgctttcgaagtcgacgctcgcgcgactgcaggtgcgcgatgtcgagcgt
gcgtttgcgcacccccgccccgccgatgctctcgcgcccgagtccgttacgcagcagttg
caggatgtgcgcgcgcaacagcccgaagtgatggcaggtttcgacgatgcgattacgcat
ctcgctgcaatcgatgcatggtgcgccgtgcatctcgacggctacctgccggaactgtcg
tcgctcacgcggctcctcggcaggttgaaggcgcccgcgtcggcgaacgcgatcgagcag
ttggaagaatcctatgatcccccatccgccgccagcgaatcatcaggccgtgatgcgtca
gcgccgctcgaaccgccgaatgacggaccggttagcgccaccgagcgcatgacggcccca
ccgggatccgcaccgacggaccgtcaggccgcgctcgctctgattcgtacggcgcgaacg
tggttcgagacccacgaacccagcagcccgattcctgtgttgctcaaacgtgcggagcag
ttcgtcggcaagccttacgccgaggtcgtcacggcaattcctgccgagcttctcgcgcag
tgggaagaaaccgagagtggttga

DBGET integrated database retrieval system