KEGG   Burkholderia ambifaria AMMD: Bamb_3469Help
Entry
Bamb_3469         CDS       T00398                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3469
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABI89023
UniProt: Q0BA00
Position
2:complement(266730..268619)
Genome map
AA seq 629 aa AA seqDB search
MDPRLLDYYNQELIYMRELATEFAQAHPKIARRLGMQAGEVADPYVERLIESFCFMAARL
QLKLDAEFPRFTGRLLEVIYPNYVAPTPSIAVARLYPGQAEGNLAAGYRIARGTSFKARV
PDGEKTACQFTSGQDVTLWPLTITDARLTGIPPDIPALDRHVPPDRQVRGALRLRLATTG
DVRIADLKGLDRLPVYLAGDEQVASHLFELLHVAGVASVIAAPGEFGVPGRSPAAVIHGA
VEHEGLGTDQNLLPLTWTKFHGHNLLHEYFACPARFWFFALNGLAEGLSRVNGREVEIVV
LLDRAPGQLANLVDASRFALFCTPVINLFKRHTDRIEISPRETEFHLVPARLAPLDYEVF
SVETVYGQVAATSDELEFRPLYQTLNNDEGNHGRYFSTRRERRLASDSARRYGTRTPYVG
TEVFLSLVDQNEAPYGEDIRFLSVDALLTNRDLATLVPRDGVRDLAMEESAPVESIGLIR
PPSPPKAPYAEREMAWRLIRQLNFNYLPLEGLDHRDGGQGLRDLLRLYLSNDNNEHSRQV
ESLVGVNTRPVTRKLPGTGPMTFGRGIECAVTVDEAGFSGVSPYLFGTILEHWLARHVSI
NSFTQTELHSMQRGRIARWPVRTGTRGVL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcgactactcgactattacaaccaggaactcatctacatgcgcgagctcgcc
accgagttcgcacaggcgcacccgaaaatcgcgcgccggctcggcatgcaggccggtgaa
gtggcggacccctacgtcgaacgcctgatcgagtcgttctgcttcatggccgcgcgcctg
cagctcaagctcgatgccgagtttccacgcttcacggggcggctgctggaagtgatctac
ccgaattacgtcgcgcccacgccgtcgatcgcggtcgcgcgcctgtatcccggtcaggcc
gaaggcaatctggccgccggctatcgtatcgcgcgcggcacgtcgttcaaggcgcgggtt
ccggatggcgaaaaaaccgcttgccagtttacgagcggacaggacgtcacgctctggccg
ctcacgatcaccgatgcacggctgacgggtattccgcctgacattccggcgctcgaccgc
catgttccgcccgaccgacaggtgcgcggtgcattgcggctgcggctggcgacgaccggc
gacgtgcgcatcgccgatctgaaggggctcgaccggttgcccgtgtatctggccggtgac
gaacaggtcgcctcgcacctgtttgagctgctgcacgtcgccggcgtcgcatccgtgatt
gccgcgcccggagaattcggcgtaccgggccgctctcccgccgccgtgattcacggtgcg
gtcgaacacgagggcttgggcaccgatcagaacttgctgccactcacctggacgaagttc
cacggacacaacctgctgcacgaatacttcgcgtgcccggcaaggttctggttcttcgca
ctcaacggccttgccgaaggcctgtcccgcgtgaacggtcgcgaggtcgaaatcgtcgtg
ctgctcgaccgggcgcccggccagctcgcgaaccttgtcgacgcgtcgcgcttcgcgctg
ttctgcacgcccgtcatcaacctcttcaaacggcacacggatcgcatcgagatttctccc
cgcgagaccgaatttcatctggtacccgcgcgactcgcaccgctggactatgaagtgttt
tcggtagagacggtgtacgggcaggtcgcagcgacctcggacgaactggaattccgtccg
ctgtatcaaacgctgaacaacgacgaaggtaaccacgggcggtacttctcgacacggcgc
gaacggcggctcgcgtccgattcggctcgccgttacggcacgcgaactccttatgtcggc
accgaagtgtttctctcgctggttgaccagaacgaggctccctacggtgaagacatccgt
ttcctgtcagtcgatgcgctgctgacgaaccgggatctcgccacgctcgtgccgcgcgac
ggcgtgcgtgacttggcaatggaggagtccgcacccgtcgaaagcatcggtctcattcgc
ccgccgagtccgcccaaagccccgtatgcggagcgagagatggcatggcgcctgatccgc
cagctcaacttcaactacctgccgctcgaaggtctcgatcaccgtgacggcggtcaggga
ctacgcgacctgctgcgcctatacctttcgaacgacaacaacgaacattcgcggcaagtc
gaaagcctcgtcggcgtcaacactcgcccggtaacacgcaagctgccgggcacgggtccg
atgacgttcgggcgtggcatcgagtgtgcagtgacagtcgacgaggcaggcttctccggc
gtcagcccctatctattcggtacgattctcgagcactggctggcacggcacgtgtcgatc
aacagcttcacgcagaccgaattgcattcgatgcagcgcggccgtatcgcacgctggccc
gtgcgcaccgggacacgcggagtgctgtga

DBGET integrated database retrieval system