KEGG   Burkholderia ambifaria AMMD: Bamb_3474Help
Entry
Bamb_3474         CDS       T00398                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3474
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: ABI89028
UniProt: Q0B9Z5
Position
2:273986..274528
Genome map
AA seq 180 aa AA seqDB search
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSD
RRFLEIDIDNFDERMKAIRPRVAFAVSNTLTGDGQMMVDMTFESMEDFSPAAIARKVEPL
RQLLEARTQLANLQTYMDGKSGAEALVTQLLHDPALLKSLAAAPKPERQADETADQDDTN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccagcagttcgcagaaattcattgcgcgcaaccgtgcgccgcgtgtgcag
atcgagtacgacgtcgaggtctacggctcggagaagaaagtcgagctgccgttcgtgatg
ggggtgctcgccgatctgtcggggaagcatccggtcgagccgctaccggcggtgtcggac
cggcgcttcctcgagatcgacatcgacaatttcgatgagcgcatgaaggcgatccggccg
cgcgtcgcgttcgccgtatcgaatacgctgacgggcgacggccagatgatggtcgacatg
accttcgagagcatggaggacttttcaccggctgcgattgcccgcaaggtcgagccgctg
cgccaactgctggaagcgcgtacgcaactcgccaatctgcagacctacatggatggcaag
tcgggtgcagaggcgctcgtcacgcagttgctgcatgacccggcgctgctcaaatcgctg
gctgccgcgccgaagcccgagcggcaagcggacgaaactgccgatcaagacgacacgaac
tga

DBGET integrated database retrieval system