KEGG   Burkholderia ambifaria AMMD: Bamb_3476
Entry
Bamb_3476         CDS       T00398                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bamb_3476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3476
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3476
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABI89030
UniProt: Q0B9Z3
Position
2:276142..276627
AA seq 161 aa
MAQDIFLKIDGINGESLDEKHKDEIEVLTWEWDIQQESTMHAGSGGGAGKATVKDLTFEH
NIDRASPNLMKYALTGKHIDQATLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKNDAEK
SRESVSLSFAKVKQEYVVQNAQGGSGGAVTASFDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcacaagatattttcctgaagatcgacggcatcaacggcgagtcgcttgacgaaaag
cacaaggacgaaatcgaggttctgacctgggagtgggacatccagcaggaatcgacgatg
cacgccggcagcggcggcggtgccggcaaggcgaccgtcaaggatctgacgttcgaacac
aacatcgaccgcgcgagcccgaacctgatgaagtacgcgctcacgggcaagcacatcgac
caggcaacgctggtcatgcgcaaggccggcggcaacccgcttgaatacctgaagctcacg
atgagcgacgtgatcgtcacgcgcgtgaagccgtcgggcagcaagaacgatgcggaaaag
agccgcgaatcggtgtcgctgtcgttcgcgaaggtcaagcaggaatacgtcgtgcagaac
gcgcagggcggcagtggtggcgccgtgaccgcgagcttcgacatcaagggcaacaaggaa
gcgtaa

DBGET integrated database retrieval system