KEGG   Burkholderia ambifaria AMMD: Bamb_3478Help
Entry
Bamb_3478         CDS       T00398                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3478
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABI89032
UniProt: Q0B9Z1
Position
2:277252..278595
Genome map
AA seq 447 aa AA seqDB search
MSWYAKVAWQEGLFFRPQLFQQQDRYFEKYAHQRAAPLSPFFFGFTHFALDHEALALGKV
VVKAAAGVFADGTPFDAPGNTPLPPPLTIRPEHLDQVIYLAVPVRLPNCEETTFDETPDS
LARYQVFDTELRDTNSMGLAPESVQLSNLRVRLLPEKELGDAWIGLALTRVTTIRADGSI
ALDDTLVPPVSGYGASDLLTSWVTKIHDLARLRANALAQRLAGTDDTTASAATVTDYLLL
QILNRYEPLLQHLLRVPATSPADVYALLIGMAGELSTHLRTNTRRPLDTHPPYQHTTPHV
CLKPVVDDTHRLLNAVLVRSAQSIVLEDRGHGMRNAVVDPVDMQGFAALVLAVHAAMPQD
VLQQQFLAQAKAGPSDKLPSLVRSHLPGIGLQALPVPPRQIPFNAGYIYYELTQGGLLWE
EVVRHGGIALHVSGEFPSLRLELWGVR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtacgccaaggtcgcctggcaggaggggctgttcttccgtccgcagctgttc
caacagcaggatcgctatttcgagaaatacgcgcatcagcgcgcggcgccgctgtcgccg
ttctttttcggtttcacgcacttcgcgctcgaccacgaggcgcttgcgctcggcaaggtg
gttgtcaaggcggccgcgggcgtgtttgccgacggcacgccgttcgatgcgccgggcaac
acgccgttgccgccgccgctgacgatccggcccgaacatctggaccaggtgatctatctg
gccgtacccgtccggttgccgaattgtgaggagaccaccttcgacgaaaccccggattcg
ctcgcacgctatcaggtgttcgacaccgaattgcgtgacacgaattcgatgggtcttgcc
cccgaatcggtgcagttgtcgaacctgcgcgtgcgtctgctgccggaaaaggagctgggc
gatgcctggatcggtctcgcgctcacgcgtgtgacgacgattcgcgcggatggcagcatc
gcgctcgacgacacgctcgtgccgccggtatccggttacggcgcaagcgacctgctgaca
agctgggtcacgaaaattcatgatctcgcgcgcctgcgcgcgaatgcgcttgcgcagcgg
ctcgccggtaccgacgacacgaccgcaagcgcggcgacagttaccgattacctgctgctg
cagatcctgaaccgctacgagccgcttctgcagcatctgctgcgtgtgccggcgacgtcg
ccggctgacgtgtatgcgctgctgatcggcatggcgggggagttgtcgacgcatttgcgc
accaacacgcgccggccactcgatacgcacccgccgtatcagcatacgacgccgcacgtg
tgcctgaagccggtcgtcgacgacacgcatcgcctgctcaacgccgtgctggtgcgcagc
gcgcagagcatcgtgctcgaggatcgcggtcacggcatgcgtaacgcggtggtcgatccg
gtcgatatgcaagggttcgccgcactggtgctggccgtgcatgcggcgatgccgcaggat
gtactgcaacagcagtttcttgcgcaggcgaaggcggggccttcggacaagctgcctagc
ctggtgcgcagtcacttgccgggcatcggcctgcaggcgctgccggtgccgccgcggcag
attccgttcaacgcgggctacatctattacgagctgacccagggtggactgctttgggag
gaagtcgtgcggcatggtggcatcgcattgcatgtgtcgggagagttcccgtcattgagg
cttgagttatggggcgtgcgctga

DBGET integrated database retrieval system