KEGG   Burkholderia ambifaria AMMD: Bamb_3479
Entry
Bamb_3479         CDS       T00398                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bamb_3479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_3479
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_3479
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V HTH_37
Other DBs
NCBI-ProteinID: ABI89033
UniProt: Q0B9Z0
Position
2:278884..281421
AA seq 845 aa
MALFDAPRTLSVSGAALPMYGDRPILTPVKLTGGETIGELFEYTLELKTPDALGFSQSIA
ANVKLDKLIGTEVTVSIQLEGKGRFIPGLVGSAGMANLGAGAREITGIVSHATIVREDGR
SIVYALTLRPWLWHATKNCDCRIFQDMSVVEITDAVLSSYPFPVEKRLTTPRPNKGWPKR
DIQRQHFESDWAFLQRLWEEWGIYYFFEHSEGKHRLVLCDSMGALKPLGEAYAALRYEPP
TGRRLDEEHIQDFSVSHALTTGAVTSVDYDYTLPRADLKVMREDPRDTGLAHQEHYTWGD
YAQPQAGAAGLSGDHNEPRTEAEYLTLVQMEAWRCQGLRAYGKGNLRGVVTGQSFVLSHY
PQDAANREYAVIACKLTIEEIGEASGSGQRYRCEADFTVQPTNEPFRLLRTIAKPRMNGV
EYAVVTCPENQEIWTDAQGRVKLQFLWDRLGKNDERSSCWVRVAGAWHGDQFGGVFLPRR
GHEVEVAFVNGDPDLPIIVGSATNAFNMPPFDLPKNQALAGYRSREIGGRRANTLAFDDT
NGKIQAHLSSDEGASQLNLGYITRIAGSAGRQNERGRGFELVTSLWGVVRSAMGMLITTE
ARPDTQGHAKDMGETVRRLTDARDTHERLAELAQQNLAQDANVDQSEVTAALRAQNDAIR
GGAMSDDAPFPEFVEPHLTLASPVGIQTTTAGSTHVASGEHLALTTGEHFGIATGRSLFA
TVKEKLRIFVYEAGIKLIAGAGSIDIEALKDAINLMAKIRIRQTATRIEIWAEEELSLRG
GKSFITLNHSGITNGTPGQWQSYAATHQMPGPKSSPGDVPAAELKVCELSTVKAAAQHAA
IVPLS
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggctttgtttgacgcaccacggacgctgtcggtttccggcgcggctctgccgatgtac
ggtgatcgtccgattctcacgccggtcaagcttaccggtggcgagacgatcggcgagttg
ttcgagtacacgctcgaactgaaaacgccggatgcgctcgggttttcgcagagcatcgcg
gcgaatgtcaaactcgacaagctgatcggcacggaagtgaccgtgtcgattcagctcgag
ggcaagggccgcttcatccccggcttggtcgggagtgccggaatggccaatcttggtgcg
ggcgcacgcgagatcaccggtatcgtcagccatgcgacgatcgtgcgtgaagacggtcgt
tcgatcgtctatgcactcacgctgcggccgtggctctggcatgcgaccaagaattgtgac
tgccgaatctttcaggatatgtccgttgtcgagatcaccgatgcggtgctctcgtcctat
ccgttcccggtcgaaaaacgccttaccacccctcggccgaacaagggatggccgaagcgg
gacattcagcgtcagcacttcgagagcgactgggcgttcctgcagcgtttgtgggaagag
tggggcatctactacttcttcgagcatagcgaaggcaagcatcgccttgtgctgtgcgac
tcaatgggtgcgctcaaaccgctaggtgaagcttatgcagcgcttcgctacgagccgccg
accggtcgacggcttgacgaggaacacattcaggacttctcggtctcccatgcgctgaca
acgggcgcggtgacgagcgtcgactacgactatacgttgccgcgcgcggacctgaaggtg
atgcgcgaagatcctcgtgacaccgggctcgctcatcaggagcattacacatggggcgat
tacgcgcagccgcaagctggcgcggctgggctctcgggcgatcacaacgagccgcgcacg
gaagcggagtacctgactctcgtgcagatggaggcttggcgttgtcaggggctgagggcc
tatggcaaaggcaacctgcggggcgtggtgaccgggcagtcgttcgtgctgtcgcattat
ccgcaggatgcggcgaatcgcgagtatgcggtgatcgcctgcaagctgacaatcgaggag
attggcgaagcgtcgggatccggccagcgataccgttgcgaagcggattttacggtgcag
ccgaccaatgagccgttccggctgctgcgtacgattgcaaagccacgtatgaacggcgtc
gaatatgccgtcgtgacgtgtccggagaatcaggaaatctggaccgatgcacagggtcgg
gtaaagctccagtttctgtgggatcggctgggcaagaacgatgagcgatcgagttgctgg
gtacgtgtggccggtgcctggcatggcgatcagttcggtggagttttcctgccgcgacgg
gggcatgaagtcgaggtcgcgttcgtcaatggtgatccggatttgccgatcatcgtgggc
agcgcgaccaatgcgttcaacatgccaccgttcgacttgccgaagaaccaggcgctcgcc
ggctatcgtagccgcgagatcggcggtcggcgcgcgaatacgctcgccttcgacgatacg
aacgggaaaatccaggcgcatctgtcgagcgacgaaggcgcctcgcagttgaatcttggg
tatatcacacgtattgccgggagtgcggggcgtcagaatgagcgtggtcggggcttcgag
ttagtaacgagcctgtggggcgtggtgcgctcggcgatgggaatgctgattacgactgag
gcacggccggatacgcagggacatgccaaggatatgggtgagacggtccggcgactcacg
gacgcgcgcgacacccacgaacgtttggccgagctggctcagcaaaacttggcgcaggac
gcgaacgtcgatcaaagtgaggtcacggccgcgttgagggcccagaacgatgcgatacga
ggtggagcaatgtcagacgatgccccgtttccggagtttgtcgagccacacctgacgctt
gccagtccagttggcatccagacaacaacagcgggtagcacgcacgtcgcaagcggtgag
cacttggcgttgacgacgggcgagcattttggcattgcgactggacgatcactgtttgca
accgtcaaggaaaaattgcggatctttgtctacgaggcggggatcaagcttattgccggc
gctggctcaatcgacatcgaagccctcaaggacgccattaacctgatggcgaaaatcagg
atccggcagactgcgacacggattgaaatctgggccgaagaggaactatcgctacgtggc
gggaagagtttcatcacgctcaatcattccggtattaccaacggcacgccgggacagtgg
cagtcctatgccgcaactcaccagatgccgggaccgaaaagttcgccgggagatgtgccg
gccgccgaactaaaggtctgtgagttgagtacggtcaaagcggcggctcagcatgcggcg
atcgtgccgctttcgtga

DBGET integrated database retrieval system