KEGG   Burkholderia ambifaria AMMD: Bamb_3953Help
Entry
Bamb_3953         CDS       T00398                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bamb_3953
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bamb_3953
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bamb_3953
    1.1.1.-  
     Bamb_3953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: ABI89507
UniProt: Q0B8L6
Position
2:850415..851479
Genome map
AA seq 354 aa AA seqDB search
MKAAVWHGRNDIRVEEVPVPAHPPAGWVQIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAALGAGVTGFALGDRVTADACQHCGTCWYCKHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGATVVIDPKASDAIAEIKALTGGY
GADVSFECIGHTATAQLAIDVIRKAGKSVMVGIFEEPTSFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRITLGDIVTHGFQELVNHKDRNVKIIVQPATA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcacggccgcaacgacatccgcgtggaagaagttcccgttccg
gcgcacccgccggccggctgggtccagatccgcgtgcactggtgcggaatctgcgggtcc
gacctgcacgaatacgtcgccgggcccgtattcatcccggtcgacgcgccgcacccgctg
acgggcctgaagggccagtgcatcctcggccacgagttcagcggcgaaatcgcggcgctc
ggcgcgggcgtgacgggcttcgccctcggcgaccgcgtgacggccgacgcgtgccagcac
tgcggcacctgctggtattgcaagcatgggctgtacaacatctgcgagaacctggcgttc
accgggctgatgaacaacggcgcgttcgccgaatacgtgaacgtgccggccgagctgctg
tacaagctgcccgagaacttcccgaccgaggccggcgcgctgatcgaaccgctcgcggtc
ggcctgcacgcggtgaagaaggccggcaacatcgtcggccagaccgtcgtcgtggtcggc
gccggcacgatcgggctgtgcacgatcatgtgcgcgaaggccgcgggcgccgggcgcgtg
atcgcgctggaaatgtcggccgcgcgcaagcagaaggcgctggaggtcggcgcgacggtc
gtgatcgatccgaaggcgtcggacgcgatcgcggaaatcaaggcgctgacgggcggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgcagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaggagccgacgtcgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctcgcgtacaacggc
gaattcgcggacgtgatccgcttcatcgcggacggccgcatcgacgtgcagccgctgatc
accgggcgaatcacgctcggcgacatcgtcacgcacggcttccaggagctggtcaaccac
aaggaccggaacgtgaagatcatcgtccagcccgcgacggcctga

DBGET integrated database retrieval system