KEGG   Burkholderia ambifaria AMMD: Bamb_4204Help
Entry
Bamb_4204         CDS       T00398                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02020  Two-component system
bam02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bam00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bamb_4204
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bamb_4204
Bacterial motility proteins [BR:bam02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Bamb_4204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal sCache_2 dCache_2 Cache_3-Cache_2 Laminin_II Mobilization_B PriC HAMP SKA1 Sigma70_ner
Motif
Other DBs
NCBI-ProteinID: ABI89757
UniProt: Q0B7W6
Position
2:1124075..1125628
Genome map
AA seq 517 aa AA seqDB search
MRTLSLNQKLASMIVILWLGLLVIAGIGAWQTRASMITDRRDQLASLVAQATSVTDHYYK
LSQQNALPEADAKQKALEAIAAMRHGTDGYISVNDSKPVIVMHPIKAELNGKDVSNFADP
NGKHLFVEIVKAGNAEGGKGFVEYLWPKPGADKPQDKTSAVQRFAPWDWYLVTGMYMDDV
RSAVLASVGRWLAMTAVLGAIATAVMVMVLKSVRANLGGELEVALDAAQRIAQGDLTARV
NVKHDDRGSLMHALHTMQGGLIDMVSRVRMGTENINVGAGEIASGNTDLSQRTEEQAAAL
VQTASSMDQMTANVKQNADSAAQAATLADQAAQVASRGSEVVDNVVRTMNEITDRSHKIG
DIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEVRSLAQRSATAAKEIKSLIV
SSNETVEHGATLVTHAGETMAEIVQSVRRVNEILDEISHASREQSAGIEQVNRAVGEMDQ
VTQQNAALVEQAAAAAHSLRDQAEALRDAVTRFALPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccctttccctgaatcagaaactcgcctcgatgatcgtcattctgtggctcggc
ctgctcgtgatcgccggcatcggcgcgtggcaaacgcgcgcatcgatgatcacggaccgc
cgcgaccagttggcgtcgctggtcgcgcaggccacgagcgtgaccgaccactactacaag
ctgtcgcaacagaatgcgttgccggaagccgacgcgaagcagaaggcgctcgaggcgatc
gccgcgatgcgccacggcaccgacggctatatctcggtcaacgactcgaagccggtgatc
gtgatgcatccgatcaaggccgaactcaacggcaaggacgtgtcgaatttcgcggatccg
aacggcaagcacctgttcgtcgagatcgtgaaggccggcaacgcggaaggcggcaagggc
ttcgtcgagtatttgtggccgaagccgggcgccgacaagccgcaggacaagaccagcgcg
gtgcagcgcttcgcgccgtgggactggtatctcgtgaccggcatgtacatggacgacgtg
cgttcggcggtgctcgcgagcgtcggccgctggctcgcgatgacggccgtgctcggcgcg
atcgcgaccgccgtgatggtgatggtgctgaaaagcgtgcgcgcgaacctcggcggcgag
ctcgaggtcgcgctcgacgccgcgcagcgtatcgcacagggcgacctgaccgcgcgcgtg
aacgtcaaacatgacgaccgcggcagcctgatgcatgccctgcatacgatgcagggcggg
ttgatcgacatggtgtcgcgcgtgcggatgggcacggagaacatcaacgtcggcgcgggc
gagatcgcgtcgggcaacaccgacctgtcgcagcgcaccgaggagcaggcagccgcgctc
gtgcagaccgcgtcgagcatggaccagatgaccgcgaacgtgaagcagaacgcggacagc
gccgcgcaggccgcgacgcttgccgatcaggccgcgcaagtcgcgtcgcgcggcagcgag
gtggtcgacaatgtcgtgcgcacgatgaacgaaatcaccgaccgctcgcacaagatcggc
gacatcatcggcgtgatcgacgggatcgcgttccagaccaacatcctcgcgctgaacgcg
gccgtcgaggcggcgcgcgccggcgaacagggccgcggcttcgcggtggtcgccgccgag
gtgcgctcgctcgcgcaacgctcggcgacggccgcgaaggagatcaagtcgctgatcgtg
tcgtcgaacgaaaccgtcgagcatggcgcgacgctcgtcacgcacgcgggcgagacgatg
gccgagatcgtgcagtcggtgcggcgcgtgaacgaaatcctcgacgagatcagccatgcg
tcgcgcgagcagagcgcggggatcgagcaggtcaaccgcgcggtgggcgagatggaccag
gtcacgcagcagaacgcggcgctcgtcgagcaggccgcggccgccgcgcattcgctgcgc
gaccaggccgaagcgctgcgcgacgcggtcacgcgattcgcattgccggcctga

DBGET integrated database retrieval system