KEGG   Burkholderia ambifaria AMMD: Bamb_4717Help
Entry
Bamb_4717         CDS       T00398                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00071  Fatty acid degradation
bam00072  Synthesis and degradation of ketone bodies
bam00280  Valine, leucine and isoleucine degradation
bam00310  Lysine degradation
bam00362  Benzoate degradation
bam00380  Tryptophan metabolism
bam00620  Pyruvate metabolism
bam00630  Glyoxylate and dicarboxylate metabolism
bam00640  Propanoate metabolism
bam00650  Butanoate metabolism
bam00900  Terpenoid backbone biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
bam01212  Fatty acid metabolism
bam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bamb_4717
   00630 Glyoxylate and dicarboxylate metabolism
    Bamb_4717
   00640 Propanoate metabolism
    Bamb_4717
   00650 Butanoate metabolism
    Bamb_4717
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bamb_4717
   00072 Synthesis and degradation of ketone bodies
    Bamb_4717
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bamb_4717
   00310 Lysine degradation
    Bamb_4717
   00380 Tryptophan metabolism
    Bamb_4717
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bamb_4717
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bamb_4717
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bamb_4717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bam04147]
    Bamb_4717
Enzymes [BR:bam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bamb_4717
Exosome [BR:bam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bamb_4717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABI90267
UniProt: Q0B6F6
Position
2:complement(1708737..1709957)
Genome map
AA seq 406 aa AA seqDB search
MRPETLMTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVDWTAIDDVIY
GCANQAGEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAIKSGEAALMVA
GGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSMPETGENVAVDY
NISRADQDLFALRSQQKAARAQQDGTLAEEIVSVTIPQKKGDPVVFSRDEHPRETSLEAL
AKLKGVVRPDGSVTAGNASGVNDGAAALLLANEATAKRFGLTPRARVLGIATAGVAPRVM
GIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIAL
GHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIERV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggagacactgatgaccgaagcttttctgtgtgatgcgattcgtaccccgatc
ggccgttacggcggcgcgctgtccggcgtgcgcgccgacgacctcggcgcggtgccgctc
aaggcgctcgtcgagcgcaaccgcgacgtcgactggacggcgatcgacgacgtgatctac
ggctgcgcgaaccaggccggcgaggacaaccgcaacgtcgcgcgcatgtccgcgctgctc
gcgggcctgccggagggcgtgccgggttcgacgatcaaccgcctgtgcggttccgggatg
gacgcggtcggcgtggccgcgcgcgcgatcaagtcgggcgaggccgcgctgatggtggcc
ggcggcgtcgaaagcatgacgcgcgcgccgttcgtgatgggcaaggccgccagcgcattc
gcgcgccaggccgacatctacgacacgacaatcggctggcgtttcgtcaatccgctgatg
aaacagctgcatggcgtggattcgatgccggagacaggcgagaacgtcgcggtcgactac
aacatcagccgcgccgatcaggatctgtttgcgctgcgcagccagcagaaggccgcgcgt
gcgcaacaggacggcacgctcgccgaggaaatcgtatcggtcacgattccgcagaagaag
ggcgatccggtcgtcttttcgcgtgacgagcatccgcgcgaaacgtcgctcgaagcgctc
gcgaagctgaagggcgtcgtgcgtccggacggctcggtcacggccggcaacgcgtcaggc
gtcaacgacggcgccgctgcgctgctgctcgcgaacgaggccaccgcgaagcgcttcggc
ctgacgccgcgcgcccgcgtgctcggcatcgcgacggccggcgtcgcgccgcgcgtgatg
ggcatcggccccgcgccggccacgcagaagctgctcgcgcggctcgggatgacgatcgac
cagttcgacgtgatcgagctgaacgaagcgttcgcgtcgcagggtctcgcggtgctgcgc
atgctcggcgtcgccgacgacgaccctcgcgtgaacccgaacggcggcgcgatcgcgctc
ggccatccgctcggcgcgtcgggcgcgcgtctggtcacgaccgcgatgtaccagctgcat
cgcaccaacggccgcttcgcgctgtgcacgatgtgcatcggcgtcggccaaggcatcgcg
atcgcgatcgaacgcgtgtga

DBGET integrated database retrieval system