KEGG   Burkholderia ambifaria AMMD: Bamb_4817Help
Entry
Bamb_4817         CDS       T00398                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00260  Glycine, serine and threonine metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_4817
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bamb_4817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABI90366
UniProt: Q0B657
Position
2:complement(1809162..1810175)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAVTAERAGKEAGLFFPSGTQ
SNLAALMAHCERGDEYLVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPLAKIAAAI
KPLDNHFARTRLLALENTIGGLVLPEGYVQEAVAFARSRGLAAHLDGARVCNAAVASGRP
IAELCAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRKVLGGGMRQSGILAAACLY
ALEHNVERLADDHANAAHLAAGLARIEQVKVLSHATNMVFAQFPEADCTPLEAWLKARGI
LTQMLYASRFVTHCDVSRADIDTFIDAVGAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcgatgctggccgcgatg
actgccgccgaagtgggcgacgacgtatggggcgacgacccgaccgtgctacgcctgcag
gcggtcacggccgagcgggccggcaaggaagccggcctgttcttcccgagcggcacgcag
agcaaccttgccgcgctgatggcccattgcgaacgcggcgacgaatacctcgtcggccag
ctcgcacacacctacaagtacgaaggcggtggcgcggccgtgctcggcagcatccagcca
cagccgatcgagaacgcaccggacggcacgctgccgctcgcgaagatcgccgcggcgatc
aagccgctcgacaaccacttcgcccgcacgcgcctgctcgcgctcgaaaacacgatcggc
ggcctcgtgttgccggaaggctatgtccaggaagccgtcgcgttcgcgcgcagccgcggg
ctggccgcgcacctcgacggtgcgcgcgtgtgcaatgccgccgtcgcatcgggtcgtccg
atcgcggaactgtgcgcaccgttcgataccgtgtcgatctgcttctcgaaagggctcggc
gcgccggtcggttcggtgctggtcggcagtcgcgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctcggcggcgggatgcggcagtcgggcattctcgcggcggcctgcctgtat
gcgctcgagcacaacgtcgaacggctggccgacgatcacgcgaacgccgcgcatctcgcg
gcggggctcgcgcgcatcgagcaagtgaaggtgctgtcgcatgcgacgaacatggtgttc
gcgcaatttcccgaagccgattgcacgccgctcgaagcgtggctcaaggcgcgcgggatc
ctcacgcagatgctgtacgcgtcacgcttcgtcacgcactgcgacgtgtcgcgcgcggac
atcgataccttcatcgacgcggtcggtgcgtatttcgcgcagcgtcgcgcgtaa

DBGET integrated database retrieval system