KEGG   Burkholderia ambifaria AMMD: Bamb_4858Help
Entry
Bamb_4858         CDS       T00398                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00562  Inositol phosphate metabolism
bam00564  Glycerophospholipid metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bamb_4858
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bamb_4858
   00565 Ether lipid metabolism
    Bamb_4858
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bamb_4858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bam02042]
    Bamb_4858
Enzymes [BR:bam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Bamb_4858
Bacterial toxins [BR:bam02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Bamb_4858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ABI90407
UniProt: Q0B616
Position
2:1859563..1861884
Genome map
AA seq 773 aa AA seqDB search
MTSRRKFLQQTATSGLAAAALSAFPPSIRRALAIPAFHETGTIKDVKHVVLLMMENRGFD
GYFGTFKGVRGYGDRFAVPSPNGRDVFHQTYTKATPATTITPYHLDARQGNAQRAGGTPH
TWADSQAAWDHGRMNRWPDAKTPLSMGYYDAAEVPFQRALADAFTLCDHYHCGMHTGTIA
NRLFYWSGTNGPNGINPADGSRVKLAALNNQFNGGNDIGPSSQGWTWTTYADRLQQAGVN
WKVYQSLIDNFGCNEMMSFCHWRAAIEQMPAARRPAYVASTDITQPVTAAGAFYDPAIDD
PLSPLAKGFGNTMPHGFLETFRDDIRNGTLPEVSWIIPPSVYSEHPGPSSPAQGAWYVQA
VLDALTANPDVWSKTVLLINYDENDGFFDHMPSPAVPSRNADGSLAGGHTLAAADVAVEY
HDFAPATSSQPAADGRPYGPGPRVPMWVVSPWSRGGWVNSQVFDHTSTLLFLEKRFGVVE
PQISAYRRAVCGDLTSAFNFRTPNNEPLPTLAGRTTKSQVDALSAAQQAAPKITPPATPS
LPAQATGVRPSRALPYELHASAQVDAGKGTVTLKFANTGRAAAVFHVYDKLHLDRVPRRY
VVEPGKALRGDWAALADDSGKYDLWVLGPNGYHRRFTGDLARLAGGRAPHPEIRVGYAGA
SGNLHLRLRNDGGSPVRFTVKSNEVYGALSGRGANDDHRHGHENDNRAGTTWTVTVHAGS
QSELHWKLDSTGHWYDFVVTADSDASFSRRVAGRVETGRHSVSDPAMGLADRF
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgccgcaaatttcttcagcaaaccgcgacttccggcctcgccgccgccgcg
ctgtccgcgtttccgccgagcatccgccgcgcgctcgcgattcccgcgtttcacgaaacg
gggaccatcaaggacgtcaagcacgtcgtgctgctgatgatggaaaaccgcgggttcgac
ggctacttcggcaccttcaagggcgtgcgcggttacggcgaccgcttcgcggtgccgtcg
ccgaacggccgcgacgtgttccaccagacctacacgaaagcaacgcccgcgacgaccatc
acgccgtaccacctcgatgcgcgccagggcaacgcgcagcgcgcgggcggcacgccgcac
acgtgggccgactcgcaggccgcgtgggaccatggccggatgaaccgctggccggacgcg
aagacgccgctgtcgatgggctattacgacgcggccgaagtgccgttccagcgcgcgctc
gccgacgcgttcacgctgtgcgaccactaccactgcgggatgcacacgggcacgatcgcg
aaccggctgttctactggagcggcaccaacggcccgaacggcatcaacccggccgacggc
agccgcgtgaagctcgccgcgctgaacaaccagttcaacggcggcaacgacatcggcccg
tcgagccagggctggacgtggacgacctacgcggaccggctgcagcaggccggcgtgaac
tggaaggtctaccagagcctgatcgacaacttcggctgcaacgagatgatgagcttttgc
cactggcgcgcggccatcgagcagatgccggccgcacgccggcccgcgtacgtcgcgtcg
acggacatcacgcagccggtgacggcggccggcgcgttctacgatccggcgatcgacgat
ccgttgagcccgctcgcgaagggtttcggcaacacgatgccgcatggcttcctcgaaacg
ttccgtgatgacatccgcaacggcacgctgcccgaggtgtcgtggatcatcccgccttcc
gtgtacagcgaacatcctgggccgtcgagccccgcgcagggcgcgtggtacgtgcaggcg
gtgctcgacgcgctgaccgcgaacccggacgtatggagcaagaccgtgctgctgatcaac
tacgacgagaacgacggcttcttcgatcacatgccgtcgccggccgtgccgtcgcgcaac
gcggacggctcgctcgcgggcggccatacgctcgcggctgccgacgtggccgtcgagtat
cacgacttcgcgccggccacgtcgagccagcccgcggccgacggccgtccgtacggcccg
ggcccgcgcgtgccgatgtgggtcgtatcgccgtggagccgcggcggctgggtcaactcg
caggtattcgaccatacgtcgacgctgcttttcctcgagaagcgcttcggcgtggtcgag
ccgcagatcagcgcgtatcgccgcgcggtgtgcggcgacctgacgagcgcgttcaacttc
cgcacgccgaacaacgaaccgctgccgacgctcgcgggccgcacgacgaaaagccaggtg
gacgcactgagcgccgcgcagcaggccgcgccgaagatcacgccgccggccacgccgtcg
ctgcccgcgcaggccaccggcgtgcgcccgtcgcgcgcgctgccgtacgagctgcatgcg
agcgcgcaggtcgatgccggcaagggcaccgtcacgctgaagttcgcgaacaccggccgc
gcggcggcggtgttccacgtctacgacaagctgcacctcgaccgcgtgccgcgccgctac
gtcgtcgagccgggcaaggcgctgcgcggcgactgggcggcgctcgccgacgacagcggc
aaatatgacctgtgggtgctcggcccgaacggctatcaccgccgcttcaccggcgacctg
gcccggctggccggcgggcgggcgccgcacccggagatccgggtcggctatgcgggcgcg
agcggcaatctgcatctgcggctgcgcaacgacggcggcagccccgtgcgcttcacggtg
aagtcgaacgaggtatacggcgcgctgtccggccgcggcgcgaacgacgatcaccgccac
ggccacgagaacgacaaccgcgccggcacgacgtggaccgtcacggtgcacgccggcagc
cagtcggaactgcactggaagctcgactcgaccggccactggtacgacttcgtcgtcacc
gccgacagcgacgcgagcttctcgcgccgcgtggccggccgcgtcgaaacgggccgccat
tcggtcagcgacccggcgatggggctcgccgaccgcttctga

DBGET integrated database retrieval system