KEGG   Burkholderia ambifaria AMMD: Bamb_5001Help
Entry
Bamb_5001         CDS       T00398                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bamb_5001
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bamb_5001
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bamb_5001
    1.1.1.-  
     Bamb_5001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc TrkA_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABI90550
UniProt: Q0B5M3
Position
2:complement(2021395..2022516)
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDLRVVDLDTPRAGPGEVRIAVAYCGICGSDLHEYADGPHAIPVDTPHPLS
GRTAPLTLGHEFCGTVVEVGAGVTTLTPGDRVAVEPEYHCHQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDDISLEQAAVMEPAAVALHALRRGELRLGDTCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAAARFGATHAFDARSLDAPVLRDAIREAAG
GLGVDVSFEAAGLPATFEAAMQGLRKGGRLVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HVYEDLLRLIGSGALDLTSIVTRTVALDDAVADGFDALLADRAQIKILVAPPRRHARRPH
TVGSIEHEPTLVV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacttcaatggcacggcccacgcgacctccgcgtggtcgatctcgacacgcca
cgcgcggggcccggcgaggtccgcatcgcggtcgcgtattgcggcatctgcggcagcgac
ctgcacgaatatgcggacggcccgcacgcgattccggtcgacacgccgcatccgctgtcc
ggccgcaccgcaccgctcacgctcggtcacgagttctgcggcaccgtcgtcgaagtcggc
gcgggcgtgacgacgctgaccccgggcgaccgcgtcgcggtcgagcccgagtatcactgc
caccagtgcgcgtactgccgctcgggctcgtacaacctgtgcgtatcgatgggcttcgcc
ggcctgatgggcgatggcgggatggccgacttcgcggtcgtgccggcctacatgctgcat
cggctccctgacgacatcagtctcgaacaggccgcggtgatggaaccggcggccgtcgcg
ctgcatgcgctgcggcgcggcgagctgcggctcggcgacacctgcgcggtgttcggcctc
gggccgattggcctgctgctgatcatgctcgcgaagctgcagggcgcgacgaccatcgtc
gcggtcgacgtgtcgccggagcggctcgccgcggccgcgcgcttcggcgcgacgcacgcg
ttcgacgcgcgctcgctcgacgcgccggtgctgcgcgacgcgattcgcgaggcggcgggc
gggctcggcgtcgacgtgagcttcgaggcggccggcctgccggccacgttcgaggccgcg
atgcaggggctgcgcaagggcggccgcctcgtgatggtcggcctgatgccgcatgcgggt
ttcgatgcgttccgcgcggtcaacgacgagctgaccttcacggcgagcgtcggctaccgg
cacgtgtacgaagacctgctgcggctgatcgggtcgggcgcgctcgatctcacgtcgatc
gtcacgcgcacggtcgcgctcgacgatgccgtcgccgacggcttcgacgcgctgctcgcc
gatcgcgcgcagatcaagatcctggttgcgccgccgcgccgtcatgcgcgccgtcctcac
accgtcgggagcatcgagcatgagccgaccctggtcgtttga

DBGET integrated database retrieval system