KEGG   Burkholderia ambifaria AMMD: Bamb_5209
Entry
Bamb_5209         CDS       T00398                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bamb_5209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_5209
Secretion system [BR:bam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bamb_5209
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: ABI90757
UniProt: Q0B516
Position
2:complement(2244169..2246937)
AA seq 922 aa
MSIAKTLRNFASGLIDGNPRPVDLHFGRAQRAVGHLLALHHADIHEGLMSGIDGQLTCVS
THDHLSPALFLGLPVSVRVTADRGGVRAINAIVREVRTGQSDGELTVYQLQVCDALSLME
GRTNARVFRSRSVPEILTTLMNEWKQRSYALARAFDFDLSGLQADRYPVRELTRQVNESD
ARFIRRLLRREGITVFAQAETVGRVHGMADEQPVHTLVFCDDPHCLKEAPAGALRLHPRD
AGAAQRDTVTLFAHRQRLSSGKVRRPSWDYKTARIDDSTAVASLHQGESGNDLAHLLTDV
AIDIPHVGDSWNDHDRITRDRILAHQFEAERYDGISNVRDLPVGHWFTLTGDPELDMKPV
EHRRFVVTSVRHDIRNNLPTQLASRAQGLFAASRNLTETVPAIPADPAEQTDTRYENRFT
CVRRGVPLKPAYDPKIDVPPVHLLTGTIVGMQGEEVFCDSAGRVRVRIHGYDPADHAHAQ
GAGTNGRAGDSAPIRVGANLAGGNFGTLFLPRVGMEVLLGCLAGDPDRLVIIGVLSNGAN
PPATFSHTGALPGNRFLSGIKTKEINGRRYNQLRLDDTPSQISAQLASEHAHTELNLGYL
TQPRENGHGEARGEGAELRTDAAAALRAARGILLSTYARTRATGGQLDRDELIRLLDQCT
ELFKSLGDYAGQHGGQSADTSGQDNVASAFRNWTPGGAPAGAADDACALLAFGAQSGALH
VTPKTHVIHAGENIDQVAQQHVQVTSGERINLHAGRGVAMFAHGDGVSAIANQGKVTIQS
QNDDTRVDSAKNIQLTAAGGKLVGTASDEVVLVTSGGAYLRLRGGDIELGCPGTFTVKSA
GHAWDGPASMNADMPTFAQDTLGRVPKLVRATDGHAAAGFEGEIQKPSGPVSNVSSDVAG
QLPAVDADQFERLAVRFIKKNV
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgtcgatagcaaaaacgctccgtaattttgcgtctggtctgattgacggaaacccgcgg
ccggtcgatctccatttcgggcgcgcgcaacgcgcggtcggccatctgttggcgctccat
cacgccgatatccacgaagggctgatgtccggcatcgacgggcagctgacctgcgtatcc
acccacgaccatctgtcgcctgcgctgtttctcgggctgcccgtgtcggttcgggtgacg
gccgatcggggcggcgtacgcgcgatcaatgcgatcgtgcgcgaagtgcggaccggtcaa
tccgacggcgagctgaccgtctatcaactgcaggtgtgtgacgcgctgtcgttgatggag
ggccgcacgaacgcccgcgtgttccgctcgcgcagcgtgccggaaatcctcacgacgctg
atgaacgaatggaaacagcgcagctacgcactcgcgcgcgcgttcgatttcgacttgtcc
gggctgcaggccgatcgctatccggtgcgcgagctcacgcgccaggtcaacgaatcggac
gcgcgcttcatccggcgtctgctgcgccgggaaggcatcacggtcttcgcgcaggccgag
acggtcggccgcgtgcacggcatggccgacgagcagccggttcacacgctcgtattttgc
gacgatccgcattgtttgaaggaggcaccggccggtgcgctgcgccttcaccctcgcgat
gcgggcgctgcgcagcgcgacacggtgacgctctttgcgcaccgccagcgcctgtcgtcc
ggcaaggtccgccgtccgtcgtgggactacaagacggctcgcatcgacgattcaacggcc
gtcgccagcctccatcagggtgaatcgggaaacgatctggcccacctgctgaccgacgtc
gcgatcgacatcccgcacgtcggcgattcgtggaacgaccacgaccgcatcacgcgcgac
cggatactggctcaccagttcgaagccgagcgatacgacgggatcagcaacgtgcgcgat
ttgccggtcggccactggttcacgctgacgggcgacccggaactggatatgaagcccgtc
gagcatcgtcggttcgtcgtcacgtcggttcgacacgatatccgcaacaacctgccaacg
cagctcgcgagccgggcgcagggactcttcgcggcgagccgtaacctgacggaaaccgtt
ccggcgatacctgccgatccagcggagcaaaccgacacacgctacgagaaccgcttcacg
tgcgtgcggcgcggcgtgccgctcaaacccgcctacgatccgaagatcgatgtgccgccg
gttcacctgctgaccggcacgatcgtcggcatgcagggcgaggaagtgttttgcgacagc
gccggccgcgtacgcgtgcggattcacggttacgacccggccgatcatgcgcacgcgcaa
ggcgccggaacgaacggccgggctggtgacagcgcaccgatccgcgtcggagcaaatctg
gcgggcggcaacttcgggacgctcttcctgccccgcgtcggcatggaagtcctgctggga
tgtcttgcaggcgacccagaccggttggtcatcatcggcgtgctgagcaatggcgcgaac
ccgcccgcgaccttcagccataccggcgcgcttcccggcaaccggttcctctccggtatc
aagaccaaggaaatcaacggcaggcgttataaccagcttcgtctggacgatacgccgtcg
caaatctcggcgcagttggcgagcgaacatgcgcataccgaattgaatctcgggtatctg
acgcagccgcgagaaaacggacatggtgaggcgcgcggcgaaggcgcggagctgcgcacc
gatgccgccgccgcattgcgcgccgcgcgcggcatcctgctgtcgacctatgcgcgcaca
cgggccaccggtggtcagctcgatcgcgatgaactgattcgcctgctcgatcaatgcacc
gaactcttcaaatcgctcggcgattacgccggccagcacggcggacagtccgccgacacc
agcgggcaggacaacgtcgccagtgcattccgcaactggacgcctggcggtgcaccagcc
ggcgcggccgacgatgcgtgcgcgctgctcgcattcggcgcgcagtccggggccctccac
gtcacgcccaaaacgcacgtcatccatgcgggcgagaacatcgatcaagtcgcgcaacaa
catgtgcaagtcacgagcggcgaacgcatcaatctgcatgccggtcgcggcgtcgcgatg
tttgcgcacggcgacggcgtgtcggcgatcgcgaatcaggggaaggtcacgatccagtcg
cagaacgacgatacgcgcgtcgactcggcgaagaacattcaattgaccgcagcgggcggg
aagctcgtcggcaccgcgagcgatgaagtcgtgctcgttacgtccggtggtgcgtatctc
cggctgcgcggcggcgatatcgagctgggatgccccggcacgttcacggtgaagtcggct
ggtcatgcttgggatggtccggcgagcatgaacgcggacatgccgacattcgctcaggac
acgcttggccgggtgccaaagctcgtccgcgcgacggacggccacgcggcggcgggattc
gaaggcgaaattcaaaagccatccgggccggtgtccaatgtgtcgagcgacgtggccggc
caactgcccgccgtcgatgccgaccagttcgaaagactggcggtgcgattcatcaagaaa
aacgtatag

DBGET integrated database retrieval system