KEGG   Burkholderia ambifaria AMMD: Bamb_5602Help
Entry
Bamb_5602         CDS       T00398                                 

Definition
(GenBank) phosphatidylserine decarboxylase-related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00564  Glycerophospholipid metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
Module
bam_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bamb_5602
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Bamb_5602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC
Motif
Other DBs
NCBI-ProteinID: ABI91149
UniProt: Q0B3X4
Position
3:38631..39878
Genome map
AA seq 415 aa AA seqDB search
MPTDRSTPATRHRLGGWMASEEAHMAAYREKIAGEARAHAGERLRTPAVQELARLFDDNA
VLRMSLTRAIDEALESGRKLGYASIGELMTVIDHLMTYTPPFSESSLIVCPLNAFLDWPM
CMPSGHAVFRDAAVNAHLKQVLNVWCDFLGGPHSCTHLDTSAPDGWFCDEARERLGLSQF
QYQEDQPHWGFASWNDFFTRRFRADARPVTAPGDPHVIVSACEAQPYHAESNLKIRDKFW
IKGQPYSLRDIFTPARLPLAERFVGGDLYQAYLSAYNYHRWHAPVRGTVTHAYRVDGTYY
SVAEAEGPDPAGLNDSQGYMTAVAARAVIAIDCDDPGIGTVVGVFVGMGDVSSCVIEVMP
GQRIDKGEEIGYFQYGGSTYCLLFEPGVIDHFVHAPPFDDDTPVVQVNAPVAIAR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgatcgcagcacgcccgccacccgccatcgcctcggcggatggatggccagc
gaggaagcgcacatggccgcgtatcgtgaaaaaattgcgggcgaagcgcgcgcgcatgcc
ggcgaacggctgcgcacgccggccgtgcaggaactcgcgcggctgttcgacgacaatgcc
gtgctgcgcatgagcctcacgcgcgcgatcgacgaggcgctcgaatcgggccgtaagctc
ggctacgcgtcgatcggcgagttgatgaccgtgatcgaccacctgatgacctacacgccg
ccgttcagcgaatccagtctgatcgtgtgcccgctgaacgcattcctcgactggccgatg
tgcatgccgtcgggccacgcggtgtttcgcgacgcggcggtcaatgcgcacctgaagcag
gtgctgaacgtctggtgcgacttcctcggcggcccgcattcgtgcacgcatctcgacacg
tcggcgcccgacggctggttctgcgacgaagcgcgcgagcggctgggcctgtcgcagttc
cagtatcaggaagatcagccgcactggggcttcgcttcgtggaacgacttcttcacgcgc
cggtttcgcgcggatgcgcggcctgtcacggcgccgggcgatccgcacgtgatcgtcagc
gcgtgcgaggcccagccgtatcacgccgagtccaacctgaaaatccgcgacaagttctgg
atcaaggggcagccgtattcgctgcgcgacatcttcacgccggcgcggctgccgctcgcc
gaacgcttcgtcggcggcgacctctatcaggcgtatctgagcgcgtacaactatcaccgc
tggcacgcgccggtgcgtggcaccgtcacgcatgcgtaccgcgtcgacggcacctactat
tcggtcgcggaagccgaaggtcccgatccggccggactcaacgactcgcagggctacatg
acggcggtggccgcgcgcgcggtgatcgcgatcgattgcgacgatccggggatcggcacc
gtggtgggcgtgttcgtcgggatgggcgacgtgtcgtcgtgcgtgatcgaggtcatgccg
gggcagcgcatcgacaagggcgaggagatcggctatttccagtacggcggctcgacctac
tgcctgctgttcgaacccggcgtgatcgaccacttcgtgcacgcgccgccgttcgacgac
gatacgcccgtcgtgcaggtcaacgcgccggtcgcgatcgcgcgctga

DBGET integrated database retrieval system