KEGG   Burkholderia ambifaria AMMD: Bamb_6423Help
Entry
Bamb_6423         CDS       T00398                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00361  Chlorocyclohexane and chlorobenzene degradation
bam00625  Chloroalkane and chloroalkene degradation
bam01100  Metabolic pathways
bam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bamb_6423
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bamb_6423
Enzymes [BR:bam01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Bamb_6423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABI91967
UniProt: Q0B1K6
Position
3:1050385..1051089
Genome map
AA seq 234 aa AA seqDB search
MSNAEQLKSEIKVVMFDQYGTVVDMQRGLTEIAAPFLKEKGWTGNPNSFVTWWRRTHFEN
SMIDALLHKEHTPYREIGHRAVAYTLERAGIQYTQEEVRYLVSCIERLKPFPDVPEALAR
LQTRYKIVVLSNGDPDMLETAKEYHKIPFDNVISVKAAESFKPHVATYTKAAEIMGVKLS
EVLFVANHAFDCIGAKSAGMRSAFIDRRKRPFGGTPHQPDIWVDDMSSLADLMV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgctgaacaactcaagagcgagatcaaggttgtcatgttcgatcaatacggt
accgtggtcgacatgcagagggggctgacggaaatcgccgcaccctttctcaaggagaag
ggttggacgggcaacccgaattcgttcgtgacgtggtggcgccgcactcacttcgagaac
tcgatgatcgatgcgctgctccacaaggagcacacgccgtaccgtgaaatcggccatcgt
gcggtcgcctataccctggagcgcgcaggcatccagtacacgcaagaggaagtccgctat
ctcgtgtcgtgcatcgagcgcctcaagccgttcccagacgttcccgaggcacttgcacgt
ctgcagacgcgctataagatcgtggttctttcgaacggcgatcccgacatgcttgaaacg
gccaaggaataccacaagattccgttcgacaacgtgatttccgtgaaagccgccgagtcg
ttcaagccgcacgtcgcaacttacacgaaggcagcggagatcatgggggtgaaactcagc
gaagttctgttcgttgcgaaccatgcattcgattgcatcggtgcaaagtcggctggcatg
cgctcggcattcatcgaccgtcgcaagcgcccgttcggaggcacgccgcaccaaccggat
atctgggttgacgacatgtcttcgctcgcggatctgatggtctaa

DBGET integrated database retrieval system