KEGG   Burkholderia ambifaria AMMD: Bamb_6481Help
Entry
Bamb_6481         CDS       T00398                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00520  Amino sugar and nucleotide sugar metabolism
bam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_6481
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Bamb_6481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABI92025
UniProt: Q0B1E8
Position
3:complement(1154845..1155873)
Genome map
AA seq 342 aa AA seqDB search
MPAPRAGQACVEATRRFLARDTWSAIVQRNRKRILVTGGAGFLGSHLCERLVELGHDVLC
VDNYFTGTKQNVAALLGNPSFEALRHDVTFPLYVEVDEIYNLACPASPIHYQFDPVQTTK
TSVMGAINMLGLAKRTHARVLQTSTSEVYGDPDVHPQPESYRGNVNPLGPRACYDEGKRC
AETLFFDYHRQQNVRIKVVRIFNTYGPRMHPNDGRVVSNFIVQALRGENITLYGDGSQTR
AFCYVDDMVDGLIRMMASPADLTGPINLGNPHEIAISELAQIILRLTGSKSRLVFRPLPK
DDPTQRCPDIGLARAHLDWAPTVGLEAGLRRTIDYFRSTVPA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgccgcgggccggtcaagcatgcgtggaggccacgcgtcgcttccttgcgcgc
gatacttggagtgcaattgtgcaacgtaatcgaaaacgaatcctcgtgacaggtggcgcg
ggtttcctcggttcgcatctttgcgagcggctggtcgaactcggtcacgacgtattgtgc
gtcgacaactatttcaccggcacgaagcagaacgtggccgcactgctcggcaacccgagc
ttcgaggcgctacgccacgacgtgacctttccgttgtacgtggaggtggacgagatctac
aacctcgcctgtccggcttcgccgatccattatcaattcgatcccgtgcagaccaccaag
accagtgtgatgggcgcgatcaacatgctggggctcgccaagcgcacgcatgcacgcgtg
ctgcaaacctcgacgagcgaagtgtacggcgatcccgacgtacatccgcaaccggagagt
taccgcggcaacgtcaacccccttgggccgcgcgcctgctacgacgaaggaaaacgttgc
gcggagacgctgttcttcgactatcaccgccagcaaaacgtgcgaatcaaggtggtccgc
atcttcaacacgtacgggccgcgcatgcatcccaatgacggccgcgtggtgtccaacttc
atcgtgcaggcgctgcgcggcgagaacatcacgctgtatggcgacggcagccagacccgg
gcgttctgctatgtcgacgacatggtcgacggtttgatccggatgatggcctcgcccgct
gacctcaccggcccgatcaatctcggcaatccgcacgagatcgcgatcagcgaactcgcg
cagatcattttgcgcctgaccggctcgaagtcgcggctcgtattccgtccgctgccgaag
gatgatccgacacaacgctgccccgatatcggcctcgcacgcgcccacctcgactgggcg
ccgacggtcgggctcgaagcggggctgcggcggaccatcgactatttccgctcgaccgtg
ccggcttga

DBGET integrated database retrieval system