KEGG   Bacillus velezensis UCMB5033: RBAU_0529Help
Entry
RBAU_0529         CDS       T02795                                 

Gene name
cfr
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase Cfr
  KO
K15632  23S rRNA (adenine-C8)-methyltransferase [EC:2.1.1.224]
Organism
bama  Bacillus velezensis UCMB5033
Brite
KEGG Orthology (KO) [BR:bama00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bama03009]
    RBAU_0529 (cfr)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bama01504]
    RBAU_0529 (cfr)
Enzymes [BR:bama01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.224  23S rRNA (adenine2503-C8)-methyltransferase
     RBAU_0529 (cfr)
Ribosome biogenesis [BR:bama03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RBAU_0529 (cfr)
Antimicrobial resistance genes [BR:bama01504]
 Gene variants
  Macrolide resistance genes
   23S rRNA methyltransferases
    RBAU_0529 (cfr)
  Phenicol resistance genes
   23S rRNA methyltransferase
    RBAU_0529 (cfr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14
Motif
Other DBs
NCBI-ProteinID: CDG28504
UniProt: S6FHA2
Position
566433..567482
Genome map
AA seq 349 aa AA seqDB search
MQQKNKYIRIQEFLKQNKFPDFRMNQIKNAVFQGRINHFNEITVLPKSLRKLLIEEFGES
ILNIAPLKVQHSEQVTKVLFEISGDEKIETVNMKYKAGWESFCISSQCGCHFGCKFCATG
DIGLKRNLTSDEMTDQILYFHLKGHSIDSISFMGMGEALANVQVFDALHVLTNPKLFALS
PRRLSISTIGIIPGIKKITQDYPQVNLTFSLHSPFNEQRSKLMPINERYPLLEVMDTLDE
HIRVTSRKVYIAYIMLPGVNDSIDHANEVVNLLRSRYKRGNLFHVNIIRYNPTVSSPMRF
EEVNEKQVVNFYKKLKSAGINVTVRSQFGIDIDAACGQLYGNYQKNKNQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaaaaacaagtatataagaattcaagagttcctgaagcaaaataaatttcct
gattttagaatgaatcaaatcaaaaatgctgtattccaagggagaataaatcatttcaat
gaaataacggttcttcctaaatccttgagaaaattgttaatagaggagttcggagagtca
attttaaatattgctcctttaaaagtgcagcattctgagcaagttacaaaagtcttattt
gaaatttcaggagacgaaaaaatagaaacggttaatatgaaatataaagccggttgggag
tcattttgtatatcctcgcagtgcggctgtcattttggctgtaaattttgtgcaacagga
gatattggtttaaaacgcaatttaacgtcagatgaaatgactgaccaaattttgtacttt
cacttaaaaggacattcaattgacagtatttcttttatgggaatgggagaagcattagcg
aatgtacaagtttttgatgctttacatgtgcttacaaatccgaagttgtttgctttaagc
cctcgcaggttatctatttcgaccataggtattattccgggcattaaaaaaatcactcag
gattatccgcaggtcaacctgacgttttcattacattctccttttaatgaacagcgaagc
aagttaatgccgattaatgaacgctacccgttattggaggtaatggacacattagatgag
catatacgtgtgacctcaagaaaagtttatattgcttatattatgctgccgggagttaat
gattctattgatcatgcgaatgaagtagtaaatcttttaagaagcagatataagagaggg
aacttgttccatgtaaacatcattagatataacccgactgttagttcacctatgagattt
gaagaagtaaatgagaaacaagttgtaaacttctataaaaaattaaagtcagcaggaatt
aacgtgaccgtcagaagtcaatttggcattgatatagatgctgcttgcggacaattatat
ggaaattatcaaaaaaataagaaccaataa

DBGET integrated database retrieval system