KEGG   Bacillus velezensis UCMB5033: RBAU_1826Help
Entry
RBAU_1826         CDS       T02795                                 

Gene name
ggt
Definition
(GenBank) membrane bound gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00430  Taurine and hypotaurine metabolism
bama00460  Cyanoamino acid metabolism
bama00480  Glutathione metabolism
bama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RBAU_1826 (ggt)
   00460 Cyanoamino acid metabolism
    RBAU_1826 (ggt)
   00480 Glutathione metabolism
    RBAU_1826 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bama01002]
    RBAU_1826 (ggt)
Enzymes [BR:bama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RBAU_1826 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     RBAU_1826 (ggt)
Peptidases and inhibitors [BR:bama01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   RBAU_1826 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CDG29794
UniProt: S6FL14
Position
2002724..2004499
Genome map
AA seq 591 aa AA seqDB search
MKKKKFMNLCFIVLLSTLLAAGSIPYHAQAKKHPFSYDDYKQVDVGKDGMVATAHPLASQ
IGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDAKTKDTTIIDSRERAPA
GATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEKALDKWGTRSMKQLITPSIKLAS
KGFPIDSVLADAISDYKDKLSHTAAKDVFLPDGEPLKEGDTLIQKDLAKTFTAIKYKGTK
AFYDGAFSKKLAETVQEFGGSMTEKDIKNFNVTIDEPIWGDYQGYHIATAPPPSSGGVFL
LQMLNLLDDFKLSQYDIRSWQKYQLLAETMHLAYADRAAFAGDPEFVNVPLKGLLNPDYI
NARRQLIDIDKVNKKPKAGDPWAYQEGSANYKQVEQPTDKQEGQTTHFTVTDRFGNVVSY
TTTIEQLFGSGIMVPGYGVVLNNELTDFDAVPGGANEVQPNKRPLSSMTPTILFKNNEPV
LTVGSPGGATIISSVLQTILNKVEYGMDLKAAVEEPRIYTNSMTSYRYEKGVPEEARTKL
NEMGHKFGSSPVDIGNVQSILIDRENGTFTGVADSSRNGAAIGVNLKKCEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaaagtttatgaatctctgttttatcgttctgctcagtacgttgctcgcg
gccggaagcatcccttatcacgctcaggctaagaaacacccgttttcctatgacgactac
aaacaggtagatgtcggcaaagacggcatggttgccaccgcccaccctctcgcttcacaa
atcggtgccgacgtgctgaaaaaaggcggcaatgcaattgacgccgcggttgccattcaa
ttcgcattaaacgtaactgaacctatgatgtcaggaatcggcggcggcggatttatgatg
gtttatgatgcgaagacgaaagacaccaccattatcgacagccgagaacgcgcaccggca
ggcgcaacaccggatatgttccttgacgaaaacggcaaagccatccctttctccgaacgc
gttacgaaagggactgcagtcggtgttccgggaacattaaaaggacttgaaaaagcgctc
gacaaatggggcacacgctccatgaaacaactcatcaccccttccattaaacttgcctca
aaaggctttccgatcgattcggttttagctgatgccatctcagattataaagacaaatta
tcacacactgctgcaaaagacgtgtttcttccggacggagaacctctgaaagaaggagac
acactcatccaaaaagacttagccaaaacatttacagctattaagtacaaaggcacaaaa
gcattctatgacggagcattctccaaaaagcttgcggaaacagtgcaggaattcggcggc
tcaatgacagaaaaagatattaaaaacttcaatgtgacgattgacgaaccgatctgggga
gattaccagggctatcatatcgcaactgctcctcctccaagctcgggcggtgttttcctg
ttgcaaatgctgaaccttctggatgattttaagctttctcaatatgatatccgttcttgg
caaaaatatcagcttctcgcagaaacgatgcatttggcttacgctgaccgcgccgcattt
gccggggatccagaattcgtcaacgtccctctcaaaggcctcttgaatccagattatatc
aatgcccgcagacagctgatagatattgataaagtcaataaaaaaccgaaagccggcgac
ccttgggcctatcaggaaggttctgcaaactataaacaagtggagcagccgactgacaaa
caagaaggccaaacgactcacttcacggtaactgatcgcttcggcaatgtcgtatcttat
acgacaacgattgaacagctgttcggttccggcattatggttcccggatacggcgttgtg
ttgaataatgagttaacagactttgatgcggtgcctggcggtgcaaatgaagtgcagccg
aataaacgtccgctcagcagcatgactccgactattttattcaaaaataacgaacctgtc
ctgactgtcggctcccccggcggagcaacgattatttcttccgtcctgcaaacgatcctg
aacaaagttgagtacggcatggatctgaaagcggcggtcgaagagccgagaatttacaca
aacagcatgacatcctatcgatatgaaaaaggagtgccggaagaagcccgcacaaaactg
aacgaaatggggcataaattcggcagcagcccggttgatatcgggaatgtgcaaagcatc
ctgatcgaccgtgaaaacggcaccttcaccggagttgccgactcaagccgaaacggagcc
gcaatcggcgtaaacttgaaaaaatgtgaaaaatga

DBGET integrated database retrieval system