KEGG   Bacillus velezensis UCMB5033: RBAU_1835Help
Entry
RBAU_1835         CDS       T02795                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00330  Arginine and proline metabolism
bama00332  Carbapenem biosynthesis
bama01100  Metabolic pathways
bama01130  Biosynthesis of antibiotics
bama01230  Biosynthesis of amino acids
Module
bama_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RBAU_1835 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RBAU_1835 (proJ)
Enzymes [BR:bama01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RBAU_1835 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2138
Motif
Other DBs
NCBI-ProteinID: CDG29803
UniProt: S6G1W4
Position
complement(2018227..2019345)
Genome map
AA seq 372 aa AA seqDB search
MTSRTKIKRVAVKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEVILVSSGAVAAGY
RKLGFIQKPESLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDECRYHNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDD
NPRSNPKAKRISHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQAN
IPDILLQAVDEAAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKESSRDVANGNMEL
SPQDIEQIKGRFSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPPKQTDQSVIDPEA
FVCHVELSIPIG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcggacgaagatcaaaagagtcgcggtgaaaatcggcagcagctcactgacg
agcctgcacggggaaatcagcagaagaaagctggaagcattggtggatcaaatcgcacag
ctgaaagacagcggctatgaagtgattttagtatcttccggcgcagtggcggcaggttat
cggaagctcggatttattcagaaaccggaaagcctccctgaaaaacaggcttctgcttcc
atcgggcagggattattaatggaggcttattcaaagctgtttttagcgcacggttatgtc
gcatcacaaattttaattacaagaagcgacttttccgatgaatgccgctaccataatgtg
cgcaatacgatgaacgtccttttggaacggggcattattccgattattaatgaaaatgac
acggtcacagtcaaccggctgaaattcggagataacgatacactcgcagcgaaggtggca
ggtttaattgatgccgacatgcttgtgattttatcagacattgacggtttatatgatgat
aatccgcgcagcaacccgaaagcgaaaagaatcagtcatgttagtgacatcactccggaa
atagaagcaagcgcgggagatgccgggagtgaaatgggaaccggcggaatgcgttcgaaa
ctggatgcttttaaaattgtgatggcctccggtattaaaggctttctcgggcaggctaac
attccggacattctgcttcaagcggtagatgaggcggctgaaggaacttattttgaagcg
gaaggaaccctgccgttaaaccacaaagaacaatggcttgcatttaattccggccccgaa
ggcgaaattgtgatggaaaaagaaagcagccgcgatgtcgcgaacggaaatatggagctg
tcaccgcaggacatcgagcagattaagggcagattcagcagcggagcggttgtcaggctg
cttgatcagcagggagaagagctcggactcggcatcgtcaactattcctcagcccagctg
aagacatttaaagaaacgccgcccaaacagaccgatcaatcagtcattgatccggaagcg
tttgtctgccacgttgaactatccattccgatcggctga

DBGET integrated database retrieval system