KEGG   Bacillus velezensis UCMB5033: RBAU_1968Help
Entry
RBAU_1968         CDS       T02795                                 

Gene name
bsaA
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00480  Glutathione metabolism
bama00590  Arachidonic acid metabolism
bama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RBAU_1968 (bsaA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RBAU_1968 (bsaA)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RBAU_1968 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CDG29936
UniProt: S6FGS0
Position
complement(2132017..2132499)
Genome map
AA seq 160 aa AA seqDB search
MTIYDINVRTITGEDMTLSAYRGKVMIIVNTASKCGFTSQLKQLQELYDTYREEGLEILG
FPCNQFMNQEPGNEAEIQEFCVKNYGVTFPMFAKVDVNGADAHPLFTYLTEQAKGMLGTK
AVKWNFTKFIVDRNGEVTGRFSPNVNPKELEDTVQRLLAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttacgatataaacgtacggaccataacaggcgaagacatgacgctatcggct
tacagaggcaaggtgatgatcattgtgaatacagcaagcaaatgcgggttcacatcccag
ctcaagcagcttcaggagctctatgatacatatcgggaggaaggtcttgaaatattggga
tttccctgcaaccaattcatgaaccaagaacctggaaacgaagcggaaattcaagagttc
tgtgtgaaaaactacggagtcacattcccgatgtttgcgaaagttgatgtcaatggagca
gacgctcatcctcttttcacatatctgacggaacaggcgaaggggatgctcggcacaaaa
gcggtcaaatggaatttcactaagtttatcgtggaccgaaacggtgaagtcaccgggcgt
ttttcaccgaacgtcaacccaaaagagcttgaagatacggtgcagaggcttttggcccga
taa

DBGET integrated database retrieval system