KEGG   Bacillus velezensis UCMB5033: RBAU_2381Help
Entry
RBAU_2381         CDS       T02795                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00071  Fatty acid degradation
bama00072  Synthesis and degradation of ketone bodies
bama00280  Valine, leucine and isoleucine degradation
bama00310  Lysine degradation
bama00362  Benzoate degradation
bama00380  Tryptophan metabolism
bama00620  Pyruvate metabolism
bama00630  Glyoxylate and dicarboxylate metabolism
bama00640  Propanoate metabolism
bama00650  Butanoate metabolism
bama00900  Terpenoid backbone biosynthesis
bama01100  Metabolic pathways
bama01110  Biosynthesis of secondary metabolites
bama01120  Microbial metabolism in diverse environments
bama01130  Biosynthesis of antibiotics
bama01200  Carbon metabolism
bama01212  Fatty acid metabolism
bama02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBAU_2381 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    RBAU_2381 (mmgA)
   00640 Propanoate metabolism
    RBAU_2381 (mmgA)
   00650 Butanoate metabolism
    RBAU_2381 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBAU_2381 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    RBAU_2381 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBAU_2381 (mmgA)
   00310 Lysine degradation
    RBAU_2381 (mmgA)
   00380 Tryptophan metabolism
    RBAU_2381 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBAU_2381 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBAU_2381 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBAU_2381 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bama04147]
    RBAU_2381 (mmgA)
Enzymes [BR:bama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RBAU_2381 (mmgA)
Exosome [BR:bama04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBAU_2381 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: CDG30349
UniProt: S6FMM0
Position
complement(2542783..2543964)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEACELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGVAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagccagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtgcgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctcgtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggagggggtttaggcgtagctgctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system