KEGG   Bacillus velezensis NAU-B3: BAPNAU_1340Help
Entry
BAPNAU_1340       CDS       T02859                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00071  Fatty acid degradation
bamb00072  Synthesis and degradation of ketone bodies
bamb00280  Valine, leucine and isoleucine degradation
bamb00310  Lysine degradation
bamb00362  Benzoate degradation
bamb00380  Tryptophan metabolism
bamb00620  Pyruvate metabolism
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00640  Propanoate metabolism
bamb00650  Butanoate metabolism
bamb00900  Terpenoid backbone biosynthesis
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01130  Biosynthesis of antibiotics
bamb01200  Carbon metabolism
bamb01212  Fatty acid metabolism
bamb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAPNAU_1340 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_1340 (mmgA)
   00640 Propanoate metabolism
    BAPNAU_1340 (mmgA)
   00650 Butanoate metabolism
    BAPNAU_1340 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAPNAU_1340 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BAPNAU_1340 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_1340 (mmgA)
   00310 Lysine degradation
    BAPNAU_1340 (mmgA)
   00380 Tryptophan metabolism
    BAPNAU_1340 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAPNAU_1340 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAPNAU_1340 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAPNAU_1340 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamb04147]
    BAPNAU_1340 (mmgA)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAPNAU_1340 (mmgA)
Exosome [BR:bamb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAPNAU_1340 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: CDH95121
Position
1390215..1391396
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRNEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTTDG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaattcggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccggaatgaacaggatcattacgctctt
ttgagccagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaaaggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacaagccttgagcagctcgcagcgctcaagcctatttttacaaccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcaaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtggtgctcgtgagtgaaaaaatagccgggttcagccgggagaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggaggtttaggcatagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system