KEGG   Bacillus amyloliquefaciens CC178: U471_02680Help
Entry
U471_02680        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00030  Pentose phosphate pathway
bamc01100  Metabolic pathways
bamc01120  Microbial metabolism in diverse environments
bamc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U471_02680
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     U471_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C ADH_zinc_N DUF3869
Motif
Other DBs
NCBI-ProteinID: AGZ54984
Position
276646..277425
Genome map
AA seq 259 aa AA seqDB search
MYQDLQGKTAIVTGSSKGIGKAIAERFGKERMNVVVNYLGDSAGAEEAADIIEKAGGRAV
TVKADVSSEEGIQALFDAAQEHFGGVDVMVNNSGFNGTEAMPHEMSLEDWQRVIDVNVTG
TFLGAKAALKHMLDRGKKGTVLNISSVHQQIPRPENVQYSASKGGIKMMTETMALNYADK
GIRVNAIAPGTIATESNKDLEDETHKQAQLKKIPMNAFGKPEEVAAAAAWMVSEEASYVT
GTTLFVDGGMTLYPSQLDR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaggatttacaggggaaaacagcaatcgtaacaggttcttcgaaaggaatcgga
aaagccattgccgaacgcttcggcaaggaacggatgaatgtggttgtgaactacctcggt
gattccgccggagcggaagaagcggcggacatcattgagaaagcgggaggccgagccgtc
accgtaaaagccgatgtatcctcagaagaagggattcaggcgctgtttgatgccgcccag
gagcatttcgggggtgtggatgtgatggtcaacaattccggctttaacgggaccgaagcg
atgccccatgaaatgagcctggaggattggcaaagggtcatcgacgtcaacgtgaccggc
acctttttgggggcgaaagcggcactgaaacatatgctcgatcgcggaaaaaaaggaacg
gtcttaaacatatcgagcgttcatcagcaaataccccgtcctgaaaacgtgcagtactcg
gcatccaaaggcgggatcaaaatgatgacggaaacgatggcgctcaattacgcagacaaa
ggcatccgggtgaatgccatcgctcccggcacgatcgccacggagtccaataaggatctg
gaagatgaaacacataaacaggcccagctgaaaaaaattccgatgaacgccttcggaaaa
ccggaagaagtcgccgcggccgccgcatggatggtgtcggaagaagcgagttacgtaacc
ggaacgacacttttcgtcgacggaggcatgacgctttatccgtctcagctggacagataa

DBGET integrated database retrieval system