KEGG   Bacillus amyloliquefaciens CC178: U471_04120Help
Entry
U471_04120        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U471_04120
Enzymes [BR:bamc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     U471_04120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 ARD
Motif
Other DBs
NCBI-ProteinID: AGZ55126
Position
436735..437238
Genome map
AA seq 167 aa AA seqDB search
MTISKHDVNAYYQKAGIVLTDNEVEDIQIMDYGLGKLEETGLQLFIYVNTDRYCSKELVL
FPRQTCPEHRHPPVGSEKGKQETFRCRWGKVYLYVEGEKTENPSVLPPEEDKEYYTVWHE
IVLEPGGQYTIPPDTKHWFQAGEEGAVVTEMSSTSTDDHDVFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcgaaacatgatgtgaatgcatactatcaaaaagcgggaatcgttctgact
gataatgaagtcgaagacattcaaatcatggattacggcttaggcaagcttgaggaaacc
gggcttcagctgtttatttacgtgaataccgaccgctactgttcgaaagaattggtgctc
ttcccgcgccagacgtgtccggaacaccgccatccgccggtcggcagcgagaagggaaaa
caagagacattccgctgccgctgggggaaggtgtatctctacgtggaaggcgaaaagaca
gagaacccaagcgtcctcccgccggaagaagacaaggaatactacaccgtctggcatgaa
attgtgcttgagccgggcggacaatacaccattccgccggatacgaagcattggtttcaa
gcgggagaagaaggggcggtcgtcacggaaatgtcatcgacaagcacggatgatcacgat
gttttcaccgacccgcgcatttaa

DBGET integrated database retrieval system