KEGG   Bacillus amyloliquefaciens CC178: U471_06810Help
Entry
U471_06810        CDS       T02893                                 

Definition
(GenBank) glutamyl-tRNA(Gln amidotransferase subunit C)
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00970  Aminoacyl-tRNA biosynthesis
bamc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    U471_06810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bamc03029]
    U471_06810
Enzymes [BR:bamc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     U471_06810
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     U471_06810
Mitochondrial biogenesis [BR:bamc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    U471_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGZ55391
Position
684864..685154
Genome map
AA seq 96 aa AA seqDB search
MSRISIEEVKHVAHLARLAITDEEAEMFTEQLDSIISFAEELNEVDTDNVEPTTHVLKMK
NVMREDEAGKGLPVEDVMKNAPDHKDGYVRVPSILD
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaatttctatagaagaagtaaagcatgtcgctcatttggcgagactcgccatt
acggatgaagaagctgaaatgttcacagaacagcttgacagcatcatctcgtttgccgag
gagcttaatgaagtggacacggataacgtggaaccgacaacacacgtgctgaaaatgaaa
aacgtaatgagagaagatgaagcgggtaaaggccttccggtcgaggatgtcatgaaaaat
gctcccgatcataaagacggctatgtccgtgtgccatctattctggattaa

DBGET integrated database retrieval system