KEGG   Bacillus amyloliquefaciens CC178: U471_11600Help
Entry
U471_11600        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bamc  Bacillus amyloliquefaciens CC178
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bamc03009]
    U471_11600
Enzymes [BR:bamc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     U471_11600
Ribosome biogenesis [BR:bamc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    U471_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 WYL_3
Motif
Other DBs
NCBI-ProteinID: AGZ55866
Position
1134450..1135343
Genome map
AA seq 297 aa AA seqDB search
MDNFFIQKNMTAREAGMTVKEYTAQLGISKRLLADIKFGGGDLLVNGEHVTVRAVLAEGD
VLKIEFPKEHVSETLVPEPVPLDILYEDDHVLVVNKQPYVSSIPSREHPSESIANGVISH
YRKSGVQSTVHLVTRLDRDTSGAMLIAKHRLSHSLLSAAQKKGLVSRRYLAVVHGIMLQK
EGTVDAPIGRKHDSIIERMVTPEGQRAVTHFQTEKAGHAFTLAALRLETGRTHQIRVHMS
YLGHPLVGDTLYGGKNEGIARQALHSERLSFVHPMTGETLVFHAPVPDDMKTLIEHM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttggacaacttttttatccaaaagaacatgactgcccgggaagccggcatgacggtaaaa
gaatatacggcgcagctcggcatttcaaagcggcttctcgctgacattaaattcggcggg
ggagacctgcttgtgaacggagagcatgtaaccgtccgcgccgtgttagcggaaggagac
gtgcttaagattgaatttccgaaggagcatgtgagtgaaacgcttgtgcctgagccggtt
cctcttgatattctttatgaagatgaccatgtgcttgtggtcaataaacagccgtatgtc
tcctcaattccatcaagagaacacccgtcggagagcatcgctaacggagtgatcagccac
taccgaaaaagcggtgtgcaatcaacggttcatcttgtcacccgccttgacagggataca
tcgggggcgatgctcatcgccaaacatcggctttcccattctcttttgtcggcagcgcag
aagaaggggcttgtcagcaggcggtatctcgctgtcgtacacggtatcatgctgcagaag
gaaggaacggtggacgcgcccatcggaagaaaacacgacagtattattgagcggatggta
acgccggagggacaacgagcggtgacgcattttcaaacggaaaaagcgggacatgcgttt
acgcttgcagccctgcggctggaaacggggcggacgcatcaaatccgggtgcacatgagc
tacctcggccacccgttagtcggtgatacactgtacggcggaaaaaatgagggaattgcg
cggcaggctcttcacagtgagcggctttcattcgtacaccccatgaccggagaaacgctc
gtttttcacgccccggtgcctgacgatatgaaaacattaattgaacacatgtaa

DBGET integrated database retrieval system