KEGG   Bacillus amyloliquefaciens CC178: U471_18760Help
Entry
U471_18760        CDS       T02893                                 

Definition
(GenBank) scoB
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00072  Synthesis and degradation of ketone bodies
bamc00280  Valine, leucine and isoleucine degradation
bamc00650  Butanoate metabolism
bamc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    U471_18760
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    U471_18760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U471_18760
Enzymes [BR:bamc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     U471_18760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AGZ56578
Position
complement(1905141..1905803)
Genome map
AA seq 220 aa AA seqDB search
MRDSRKRMIKRAVKEIKDGMNVNLGIGMPTLVANEIPNDYNVLLQSENGLLGIGPYPAEG
TEDPDLINAGKETITEVKGASYFDSAESFAMIRGGHIDVAILGGMEVSERGDLANWMIPG
KMIKGMGGAMDLVHGAKRIIVIMEHVNKYGESKVRTECTLPLTGRQVVDRLITDLAVFDF
HDGRMTLTELQEGVTMEEVFEKTEGHFTVSQSLKNGIRPK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagagatagcagaaaacgaatgatcaaacgggctgtaaaggaaattaaggacggaatg
aatgtgaacttggggatagggatgccgacgcttgtagccaatgagataccgaatgattat
aacgtcctgcttcagtctgaaaacggcttgctcgggatcgggccttatccggcggaagga
acggaggaccccgatctgatcaacgcgggaaaagaaaccatcaccgaagtaaagggagcc
tcgtattttgacagtgccgaatcctttgccatgattcgcggcggccacattgatgtagcg
atcctcggcgggatggaagtgtccgaacggggagatttggcgaactggatgatccccgga
aaaatgatcaaaggaatgggcggcgcaatggacctagttcacggagcaaaacggattatt
gtcattatggagcacgttaataaatatggggaatctaaagtgagaacggaatgtacgctg
cctttaaccggcaggcaggtggtcgatcggctgatcacagatttggctgtattcgatttt
catgatggccgtatgacgctcaccgaactgcaggaaggtgtaacaatggaggaggtcttt
gagaaaacagaaggtcattttactgtcagccagtcgttaaaaaacgggatcagaccaaaa
tga

DBGET integrated database retrieval system