KEGG   Bacillus amyloliquefaciens CC178: U471_18820Help
Entry
U471_18820        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00780  Biotin metabolism
bamc01100  Metabolic pathways
Module
bamc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bamc_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bamc_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U471_18820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bamc01007]
    U471_18820
Enzymes [BR:bamc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     U471_18820
Amino acid related enzymes [BR:bamc01007]
 Aminotransferase (transaminase)
  Class II
   U471_18820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase bPH_2
Motif
Other DBs
NCBI-ProteinID: AGZ56584
Position
complement(1911206..1912366)
Genome map
AA seq 386 aa AA seqDB search
MDFDGWLLGRLDAVKRDGLYRTLRTQETALKTKGQKRQTWASNDYLGLSKDERLITAAQT
AMSRFGAGSGGSRLTTGNTVWHEKLEHTIADFKQTEAALLFSSGYLANIGVLASLPQKGD
VILSDQLNHASIVDGCRLSKAETIVYRHIDMADLEKKLASVQARNRRFIVTDGVFSMDGT
IAPLDRIMALAKQYQAFVIADDAHATGVLGENGGGTSDYFGVCPDVVIGTLSKAVGTEGG
FAAGSNIFIDFLLNQARTFIFQTALPPSICAASHTAFDIISDMHDTRRELQSSVKMIKTR
LADMGFTVRGGDTPIIPVIIGDAKTAVSAAALLEKKGICAPAIRPPAVPEGESRIRLTVT
ADRSLQDIDELTEAFDSIRKELNINK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggattttgacggatggctcctcggaaggctcgatgcggtgaaaagagacgggctgtat
cggacgctgcgaacacaggaaaccgctctcaaaaccaaagggcaaaagcggcagacctgg
gcgtccaatgactatttaggcctgtcaaaagatgagcggctgatcacagccgcgcaaacg
gcgatgagccggttcggagcgggaagcggcggctcacggttaacgacaggaaatactgtg
tggcacgaaaaacttgaacacacaatcgcggattttaaacagacggaagcggctttattg
ttttcaagcggttacttggcaaatatcggcgtgcttgcctcactgcctcaaaaaggcgat
gtcattttaagcgatcaactgaaccatgcgagcattgttgacggctgccgtttatcaaaa
gcggaaaccatcgtgtaccgccatattgatatggctgatcttgagaaaaaacttgcctcc
gtccaggctcggaaccgccgcttcatcgtcacagacggcgtcttcagcatggacggcacc
atcgcgcctcttgaccgcataatggcgcttgcaaagcagtaccaggcatttgtgatagca
gatgacgcgcatgcaaccggtgtactcggggaaaacggcgggggaaccagtgactatttc
ggtgtttgtcctgatgttgtcatcggcacattaagcaaagctgtaggaacggaaggcggt
tttgccgcgggatcaaacattttcattgattttttgctgaatcaggcgcggacgtttatt
tttcagacggccctcccgccgtcaatttgtgcggcttcgcatacggcatttgacatcata
tcagatatgcacgatacgcgccgtgagctgcagtcgtctgtcaaaatgataaaaacgcgt
ctggccgatatgggctttaccgtaagaggcggagatacaccgattatccccgttatcatc
ggtgatgcaaaaacagcggtttcagccgctgcactgctggagaaaaagggaatctgcgcc
ccggccatccgcccgcccgccgttccggaaggcgaaagcagaatcaggctgaccgttacg
gcggatcgcagcttacaggatatagacgagctgacagaagcatttgattccattagaaaa
gagctgaatataaacaaatga

DBGET integrated database retrieval system