KEGG   Bacillus amyloliquefaciens CC178: U471_23200Help
Entry
U471_23200        CDS       T02893                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00071  Fatty acid degradation
bamc00072  Synthesis and degradation of ketone bodies
bamc00280  Valine, leucine and isoleucine degradation
bamc00310  Lysine degradation
bamc00362  Benzoate degradation
bamc00380  Tryptophan metabolism
bamc00620  Pyruvate metabolism
bamc00630  Glyoxylate and dicarboxylate metabolism
bamc00640  Propanoate metabolism
bamc00650  Butanoate metabolism
bamc00900  Terpenoid backbone biosynthesis
bamc01100  Metabolic pathways
bamc01110  Biosynthesis of secondary metabolites
bamc01120  Microbial metabolism in diverse environments
bamc01130  Biosynthesis of antibiotics
bamc01200  Carbon metabolism
bamc01212  Fatty acid metabolism
bamc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U471_23200
   00630 Glyoxylate and dicarboxylate metabolism
    U471_23200
   00640 Propanoate metabolism
    U471_23200
   00650 Butanoate metabolism
    U471_23200
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U471_23200
   00072 Synthesis and degradation of ketone bodies
    U471_23200
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U471_23200
   00310 Lysine degradation
    U471_23200
   00380 Tryptophan metabolism
    U471_23200
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U471_23200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U471_23200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U471_23200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamc04147]
    U471_23200
Enzymes [BR:bamc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U471_23200
Exosome [BR:bamc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U471_23200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AGZ57018
Position
complement(2380303..2381484)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGVAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagtcagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggcaggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggccagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctggtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggagggggtttaggcgtagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system