KEGG   Bacillus amyloliquefaciens LFB112: U722_01060Help
Entry
U722_01060        CDS       T02965                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    U722_01060
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     U722_01060
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     U722_01060
    1.1.1.-  
     U722_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NADH_4Fe-4S ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AHC40771
Position
182767..183813
Genome map
AA seq 348 aa AA seqDB search
MKALVWTPNDKLEYQEVDEPQIRKSNDVKVKIFGTGICGTDLNVLKGKMNATHHMIMGHE
SVGAVVEIGPDVTNVKVGDRVVIDPTQFCGKCHYCRRGLTCYCETFEDWQLGIGAHGTFA
EYYVGEDRFMYRIPDSMEWERATLVEPLSCVLNVVDKASIQPEDSVLVLGSGPIGLLVQM
MVKKLARLTVATEIGSFRSEAASRISDYVYHPEALTVDEVKRINQGRKFDVIFDAIGNQL
DWAYPFIEKGGRIVPMGFDDTYEMTVRPYQLLSNGVTIVGTGEARQIMEAALACASDLPQ
LYDFITEKTELKNYEEAIDHLMGIDPVTKERKDISAIKTILVSDPELL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttggtctggactcctaatgataagcttgaatatcaagaggtggacgagcct
caaattcggaaatccaatgatgtgaaagtgaaaattttcggcaccggtatctgcggaacg
gatttaaatgtgttgaaaggaaaaatgaatgcaacccatcatatgattatggggcatgaa
tcggtgggagcggtcgtggaaatcggaccggacgtgacaaatgtaaaagtcggagaccgc
gtcgtgattgatcctacgcagttttgcgggaaatgtcattattgccggagagggctgacg
tgttattgcgaaaccttcgaggattggcagctcggaatcggggcgcacggaacgtttgcg
gaatattacgtcggagaagacaggttcatgtacagaattccggattcaatggaatgggag
cgggccacattggttgagcctctctcctgtgtgctgaatgttgtggacaaagcttcgatt
cagccggaggactcggtcttggttttggggtcggggccaatcggactgcttgtgcaaatg
atggtgaaaaaactggcgcggttgacggttgcgactgaaataggcagtttccgaagcgag
gcggcgagccggatatcggattatgtctaccaccctgaagcattaaccgtggatgaagtg
aaacggattaatcaaggaagaaaatttgatgtaatttttgacgcgatcggcaatcagctt
gattgggcttatccttttattgaaaagggaggcagaatcgtgccgatgggctttgatgat
acgtatgagatgacagtcaggccgtaccagctgctgtcaaacggcgtaacgattgtgggc
acaggtgaagcccgtcagatcatggaggctgcgttagcatgcgcgtccgaccttccgcag
ctctatgattttattacggaaaagacggaactgaagaattatgaagaagccattgatcat
ctcatgggcatcgacccggtgacaaaagaaagaaaggatatcagcgcaataaaaacgatt
cttgtgtctgatccggaacttttataa

DBGET integrated database retrieval system