KEGG   Bacillus amyloliquefaciens LFB112: U722_01235Help
Entry
U722_01235        CDS       T02965                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00361  Chlorocyclohexane and chlorobenzene degradation
bamf00625  Chloroalkane and chloroalkene degradation
bamf01100  Metabolic pathways
bamf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    U722_01235
   00361 Chlorocyclohexane and chlorobenzene degradation
    U722_01235
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     U722_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AHC40801
Position
216973..217677
Genome map
AA seq 234 aa AA seqDB search
MSHYRTLLFDIDNTLLDFTASETDALQKLFQGSKLELTAEVEARYKALNQGLWKAFEEGE
MTRDEVVNTRFALLFKEYGLEADGVLMNQAYRQYLEEGHQMIDGAYELIERLSPLFDLYI
VTNGVSTSQYKRLGDSGLYPFFKDVFVSEDTGFQKPMKEYFDYVFARIPGFSAGHGLIIG
DSLSADIKGGQMAGMDTCWFNPGKKANESGIIPTYEIHSLDELYDVLNVEVVAL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattaccgtacgttattatttgatatagacaatacgctgctggattttaccgct
tcagaaaccgatgctcttcaaaaattgttccaaggttcaaagctggagctgacggcagag
gtggaagcccgttataaagcgttaaatcaagggctgtggaaggcgtttgaagagggggaa
atgacccgcgatgaagtggtgaatacacggtttgcccttttgtttaaagaatacggcctt
gaagccgacggcgtgctgatgaatcaggcgtaccgccaatacttagaagaagggcaccag
atgatagacggagcttatgagctgattgaacggctgagtcctttatttgatttatacatc
gtgacgaacggcgtctcaacatcacaatataagcggctgggcgactccggtctgtatccg
ttttttaaagatgtgtttgtatctgaggacacgggttttcaaaagccgatgaaggaatac
tttgattatgtatttgcgagaattcccggtttttctgccgggcacgggcttattatcggc
gattcattgagcgcggacataaaaggcggtcagatggcgggaatggatacgtgctggttt
aatcccggaaagaaagcaaatgagtccgggatcatcccgacgtatgaaattcattcgctt
gatgagctgtatgatgtgctgaacgtggaggttgtcgctttatga

DBGET integrated database retrieval system