KEGG   Bacillus amyloliquefaciens LFB112: U722_02125Help
Entry
U722_02125        CDS       T02965                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00030  Pentose phosphate pathway
bamf01100  Metabolic pathways
bamf01120  Microbial metabolism in diverse environments
bamf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U722_02125
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     U722_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 THF_DHG_CYH_C Epimerase SPOR
Motif
Other DBs
NCBI-ProteinID: AHC40969
Position
434940..435725
Genome map
AA seq 261 aa AA seqDB search
MYTDLKGKVVAITGASSGLGKAMAIRFGQEQAKVVVNYYSNEKDAQTVKEEIQKAGGEAV
IVQGDVTKEEDVKNIVQTAVKEFGTLDVMINNAGMENPVQSHEMPLKDWNKVINTNLTGA
FLGSREAIKYYVENDIQGNVINMSSVHEMIPWPLFVHYAASKGGIKLMTETLALEYAPKR
IRVNNIGPGAINTPINAEKFADPVQKKDVESMIPMGYIGEPEEIAAVAVWLASKESSYVT
GITLFADGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtacacggatttaaaaggaaaagtcgttgccattacgggagcttcatcaggattagga
aaagcgatggcgatccgcttcggacaggagcaggcgaaagtcgtggttaactactatagt
aatgaaaaagacgcccaaaccgttaaagaagagattcaaaaagcgggaggcgaagctgtc
atcgttcaaggagacgtcacaaaagaagaagatgtcaaaaacatcgtgcagaccgcagtg
aaggaattcggcacattggatgtcatgatcaataacgccggcatggaaaatccggttcag
tcgcatgaaatgccgcttaaagactggaacaaagttatcaataccaatctgaccggcgct
ttcttaggaagccgcgaagccataaaatattacgtagagaatgatattcaaggaaacgtc
attaacatgtcaagcgtacatgaaatgattccgtggccgctgtttgtccactacgcggcg
agtaaaggcggcatcaaattgatgacggaaacgctggcgcttgagtacgcgccgaagcgc
atccgtgttaacaatatcggaccgggcgccatcaatacgccgatcaacgcggaaaaattt
gccgatcccgttcagaaaaaagatgtggaaagcatgattccgatgggatatatcggtgag
ccggaagaaatcgcggctgtcgccgtctggcttgcttcaaaggaatcaagctatgtgacc
gggattacgctgtttgctgacgggggaatgaccaaatatccgtctttccaggcaggccgc
ggataa

DBGET integrated database retrieval system