KEGG   Bacillus amyloliquefaciens LFB112: U722_02850Help
Entry
U722_02850        CDS       T02965                                 

Definition
(GenBank) radical SAM protein
  KO
K15632  23S rRNA (adenine-C8)-methyltransferase [EC:2.1.1.224]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bamf03009]
    U722_02850
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bamf01504]
    U722_02850
Enzymes [BR:bamf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.224  23S rRNA (adenine2503-C8)-methyltransferase
     U722_02850
Ribosome biogenesis [BR:bamf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    U722_02850
Antimicrobial resistance genes [BR:bamf01504]
 Gene variants
  Macrolide resistance genes
   23S rRNA methyltransferases
    U722_02850
  Phenicol resistance genes
   23S rRNA methyltransferase
    U722_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14
Motif
Other DBs
NCBI-ProteinID: AHC41100
Position
557131..558180
Genome map
AA seq 349 aa AA seqDB search
MQQKNKYIRIQEFLKQNKFPDFRMNQIKNAVFKGRINHFNEITVLPKSLRKLLMNEFGES
ILNIAALKVQHSEQVTKVLFEISGDEKIETVNMKYKAGWESFCISSQCGCHFGCAFCATG
DIGLKRSLTSDEMTDQILYFHLKGHSIDSISFMGMGEALANVQVFDALHVLTNPELFALS
PRRLSISTIGIIPGIKKITQDYPQVNLTFSLHSPFNEQRSKLMPINERFPLLEVMDTLDE
HIRVTSRKVYIAYIMLPGVNDSIDHANEVVRLLRSRYKRGNLFHVNIIRYNPTVSSPMRF
EEVNEKQVVNFYKKLKSAGINVTVRSQFGIDIDAACGQLYGNYQKNKNR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaaaaacaagtatataagaattcaagagttcctgaaacaaaataagtttcct
gattttagaatgaatcaaatcaaaaatgctgtgttcaaagggagaataaatcattttaat
gaaataacggttcttcctaaatccttgagaaaattgttaatgaatgagtttggagagtca
attttaaatattgctgctttaaaagtgcagcattctgagcaagtaacaaaagtcttattt
gaaatttcaggagacgaaaaaatagaaacggtcaatatgaaatataaagctggctgggag
tcattttgtatatcctcgcagtgcggctgtcattttggctgtgcattttgtgcaacagga
gatattggtttaaaacgcagcttaacatcagatgaaatgactgaccaaattttgtacttt
cacttaaaaggacattcaattgatagtatttcttttatgggaatgggagaagcattagcg
aatgtacaagtttttgatgctttacatgtgcttacaaatccggagttgtttgctttaagc
cctcgtcggttatctatttcgaccataggtattattccgggcattaaaaaaatcactcag
gattatccgcaggtcaacctgacgttttcattacattctccttttaacgaacagcgaagc
aagttaatgccgataaatgaacgcttcccgttattggaggtaatggacacattagatgag
catatacgtgtgacctcaagaaaagtttatattgcttatattatgctgccgggagttaat
gattctattgatcatgcgaatgaagtagtacgtcttttaagaagcagatataagagaggg
aacttgttccatgtaaacatcattagatataacccgactgttagttcacctatgagattt
gaagaagtaaatgagaaacaagttgtaaacttctataaaaaattaaagtcagcaggaatt
aacgtgaccgtcagaagtcaatttggcattgatatagatgctgcttgcggacaattatat
ggaaattatcaaaaaaataagaaccgataa

DBGET integrated database retrieval system