KEGG   Bacillus amyloliquefaciens LFB112: U722_05610Help
Entry
U722_05610        CDS       T02965                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00270  Cysteine and methionine metabolism
bamf00670  One carbon pool by folate
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01120  Microbial metabolism in diverse environments
bamf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    U722_05610
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    U722_05610
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     U722_05610
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     U722_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR ExbD
Motif
Other DBs
NCBI-ProteinID: AHC41605
Position
complement(1085361..1087202)
Genome map
AA seq 613 aa AA seqDB search
MGLLQDLKERILIGDGAMGTLLYSYGIDRCFEELNVSKPEEIKRIHKAYVEAGADIIQTN
TYGANFIKLSRYGLEDETKKINQEAVRIARASSDGAYVLGTMGGIRTFNKNAYSLEEIKR
SFREQLYLLLHEEPDGLLLETYYDLEEAREVLKIARKETELPIMLNVSMHEQGVLQDGTP
LREALRSIADLGADITGINCRLGPYHMIEALTEVPIFRDTYLSVYPNSSLPSLEEGRLVY
DTDDAYFRESAVQFRTQGARIIGGCCGTTPNHIRAMAEAVRGLSPVTDKEVKIRREEEVI
SVRNERTEPGLNEIAAQKRSIIVELDPPKKLNFDKFLQAATELKETGIEALTLADNSLAT
PRISNAACGSLLKERLDIRSLVHITCRDRNIIGLQSHLMGLDTLGLTDILAITGDPSKIG
DFPGATSVYDLTSFDLIRLIKQFNEGISLSGKPLGKKTNFSVAGAFNPNVRHLDKAVKRL
EKKIECGADYFVSQPVYSEQQLIDIHHETKHLKTPVYIGIMPLTSSRNAEFIHHEIPGIK
LSDSIREKMALAGEDKQKQKAESLAIAKSLLDTACELFNGIYLITPFLRSDLTSELAAYI
KQKDEKRADVYLH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgggactattacaagacttaaaagaacggattttaatcggagacggcgcgatgggcact
ctcctctattcctacggcattgacagatgttttgaggaactgaacgtatcaaagcccgag
gaaatcaagcggatacataaggcttacgtcgaagccggagcagacatcatccagacaaat
acgtacggcgcgaattttattaagctctcaagatacggacttgaggatgaaacgaaaaaa
atcaatcaggaggcggtcagaatcgcgcgcgcttcctcagacggcgcttatgtattggga
acgatgggcggcatccgcacatttaacaaaaacgcctacagcctggaggagattaaacgc
agctttcgggagcagctttatttattgcttcacgaagagccggacggtctgctcctggaa
acatactatgatttagaagaggcgcgcgaagtgctgaagatagcgagaaaagaaacggaa
cttccgattatgctgaatgtatccatgcacgaacagggcgtgctgcaggacggaacgccg
cttcgggaagccctcaggtcaattgccgatctcggcgctgacataacgggaatcaattgc
cggctcggcccgtaccacatgattgaagcgctcaccgaagtgccgatattccgtgacact
tatttatcggtctatccgaacagcagcctcccgtctttagaagaaggccggcttgtttat
gatacggacgatgcctatttccgggagagcgccgtacagttccgcactcagggcgcgcgc
attatcggcggctgctgcggtacgacgccaaaccatatcagagccatggctgaagcggtc
cgcggactttcccccgtcactgataaagaagtgaaaatcagacgggaagaagaagtcatc
tccgtccggaatgaacggaccgagccgggtttaaacgaaatcgccgctcaaaaacggtca
attatcgtagagcttgatccgccgaaaaaattgaattttgacaaatttctgcaagcggcg
actgaattaaaagaaaccggcatagaagcgctgacgctcgccgacaattcattggcgaca
ccgcggatcagcaatgccgcctgcggttcattgctgaaagaacgccttgatatccgttct
ctcgttcacattacatgcagagaccgcaacatcatcggccttcagtcacatttaatgggg
ctggatacgctcgggctcaccgacattttagccatcacgggtgatccttcaaaaatcggc
gactttccgggggctacctccgtctatgatttaacgtcctttgacttgatcaggctgatt
aaacaattcaacgagggcatttctttatcagggaaaccgctcggcaagaaaacgaacttt
tccgtagccggagcatttaatccgaatgtccgccatcttgataaagcggtaaaacggctg
gagaaaaaaatcgagtgcggagctgactacttcgtgtcccagcctgtctactcggagcag
cagctcattgacattcatcatgaaacgaaacatctcaaaacaccggtgtatatcggaatt
atgccgttaacgagcagccgcaacgcagagtttattcatcatgaaatcccgggcattaag
ctgtcagacagcatccgggaaaaaatggcgctcgccggcgaagacaagcaaaagcagaaa
gccgaaagcctcgccatcgccaagtcgcttctcgacacggcgtgcgaactgtttaacgga
atttatttaatcaccccgtttctccgttctgatttgacatcagaacttgcagcttatatt
aagcaaaaggatgaaaagcgggctgatgtatatttgcattga

DBGET integrated database retrieval system