KEGG   Bacillus amyloliquefaciens LFB112: U722_19800Help
Entry
U722_19800        CDS       T02965                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00220  Arginine biosynthesis
bamf00330  Arginine and proline metabolism
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01130  Biosynthesis of antibiotics
bamf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    U722_19800
   00330 Arginine and proline metabolism
    U722_19800
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     U722_19800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AHC44268
Position
complement(3858243..3859133)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKHD
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaacatgat
gaagagctgaaaaatttgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacaccctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcgggtatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgt
gaatacattaaggaaacaggcatgaaagtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacctgtcagactgtgacggcgttcacctc
agccttgatctagacggccttgatccgagcgacgcacccggcgtaggcacgcctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggaaatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagccgtcgagctggtggaatctttgttgggaaaaaaactattataa

DBGET integrated database retrieval system