KEGG   Bacillus amyloliquefaciens IT-45: KSO_004435Help
Entry
KSO_004435        CDS       T02462                                 

Definition
(GenBank) 4-nitrophenyl phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00627  Aminobenzoate degradation
bami01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KSO_004435
Enzymes [BR:bami01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     KSO_004435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AGF26384
Position
840556..841326
Genome map
AA seq 256 aa AA seqDB search
MKDYKGYLIDLDGTMYNGTEKIEEACEFVRTLKARGIPYLFVTNNSSRTPKQVADKLMSF
DIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLSFGEENADFVVVGI
DRGITYEKLATGCLAIRNGARFISTNGDVAIPTERGLLPGNGSLTSVLTVSTGVEPVFIG
KPESIIMEQAMRVLGTDISETLMVGDNYATDIMAGLNAGMDTLLVHTGVTKREHMADYDR
KPTYAIDSLTEWIEHL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattataaaggatatttgatagatttggacggcacaatgtacaacgggacggaa
aaaatcgaagaagcgtgtgaattcgtgagaacgcttaaagcgcgcggcattccgtattta
ttcgtgacgaacaattcttcccggacgccgaagcaggtggcggacaagctgatgagcttt
gacattccggcaactgaagagcaggtcttcacgacgagcatggcgactgcgcagcatatc
gcccagcagaaaaaagacgcgtcggtgtatgtgatcggcgaagaaggcatccgccaggcc
attgaagaaaacgggctgagcttcggagaagaaaacgcggactttgtcgttgtgggaatc
gaccgcggcattacatatgaaaagttggcaacgggatgccttgcgatcagaaacggcgcc
cggttcatttcaacaaacggcgacgtcgccattccgactgaaagagggcttttaccaggg
aacggttcgctcacatccgttttgacggtgtcaacgggcgttgagcctgtctttatcggc
aagcctgaatccattattatggaacaggcgatgcgtgtgctcggaacggatatttccgaa
acactcatggtcggcgataactatgcaacggatattatggccggcctcaatgcgggcatg
gatacgctgctggttcataccggagtgacaaagcgtgagcatatggcagattacgaccgg
aagccgacatatgcgattgactctttaaccgaatggattgaacatctataa

DBGET integrated database retrieval system