KEGG   Bacillus amyloliquefaciens IT-45: KSO_005720Help
Entry
KSO_005720        CDS       T02462                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00010  Glycolysis / Gluconeogenesis
bami00053  Ascorbate and aldarate metabolism
bami00071  Fatty acid degradation
bami00280  Valine, leucine and isoleucine degradation
bami00310  Lysine degradation
bami00330  Arginine and proline metabolism
bami00340  Histidine metabolism
bami00380  Tryptophan metabolism
bami00410  beta-Alanine metabolism
bami00561  Glycerolipid metabolism
bami00620  Pyruvate metabolism
bami00625  Chloroalkane and chloroalkene degradation
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01120  Microbial metabolism in diverse environments
bami01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSO_005720
   00053 Ascorbate and aldarate metabolism
    KSO_005720
   00620 Pyruvate metabolism
    KSO_005720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KSO_005720
   00561 Glycerolipid metabolism
    KSO_005720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSO_005720
   00310 Lysine degradation
    KSO_005720
   00330 Arginine and proline metabolism
    KSO_005720
   00340 Histidine metabolism
    KSO_005720
   00380 Tryptophan metabolism
    KSO_005720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KSO_005720
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KSO_005720
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KSO_005720
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     KSO_005720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGF26641
Position
complement(1092587..1093957)
Genome map
AA seq 456 aa AA seqDB search
MNSIPSIVSKHKAYFAAGHTRPLESRLNILQKLKQAIKTQEADIAAALYQDLHKSEQEAY
TTEIGIVLEEISFVMKRLRKWVKPKRVKTPLTHLGSKSMIIPEPYGTVLVIAPWNYPLQL
ALSPLIGAIAAGNTVVLKPSEYTPAVSAVLSKLISSVFPSDYVAMAEGGPDVSTVLLQQP
FDYIFFTGSVAVGKIVMEAASKQLIPVTLELGGKSPCIVHKDADIQLAAKRIVFGKFTNA
GQTCIAPDYLFVHQDIKTKLIEEMKHAISEFYGPQPEQNPQYGKIVSERHYQRLLSFLND
GVPLTGGQFNPEHHKIAPTILDQVKDDSPVMQEEIFGPILPLFTYGDIDEVIEKVQSRPK
PLALYVFTTNKGIERTVLENLSFGGGCVNDTLMHVATPYLPFGGVGESGIGSYHGFNSFN
AFTHKKSVVKQTNRFDLAFRYPSSKNGLRMIRKILK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatcccctctatcgtcagcaagcacaaagcctattttgcggcggggcatacg
agaccgctagaatcaaggctgaacatattgcaaaagctgaaacaagccatcaaaacacaa
gaagccgatatagcagccgctctctatcaggatctccacaaatccgaacaggaggcgtac
acgacagaaatcggaattgttctggaagaaatcagttttgtgatgaagcggctgagaaaa
tgggtcaaaccgaagcgagtcaaaacgcctctgactcacctgggctcgaaaagcatgatt
atccctgagccatatggaaccgttttggtgattgcgccttggaattatcccttgcagctg
gcgctttcacccttgattggagccattgcggccggaaacacagtcgttctcaaaccgtca
gaatatacgcctgcggtttccgctgttctttctaaacttatcagcagcgtttttccgagt
gattatgtcgctatggcggagggcgggcccgacgtcagcactgttttattacagcagccc
tttgactatattttcttcacaggaagcgttgccgtgggaaaaatcgttatggaggccgcc
tccaaacaattaattcccgttaccttggagctcggcggcaaaagtccctgcattgtccat
aaggatgctgatatacagcttgccgccaaacgcatcgtcttcgggaaatttacaaatgca
gggcaaacctgcatcgcaccggattatttatttgtccaccaagatatcaaaacgaagctc
atagaagaaatgaagcatgcgatcagtgaattttacggccctcagcctgaacaaaatccg
cagtacggcaaaatcgtcagtgaacgccactatcagcggctgctcagctttctgaatgat
ggcgtcccgcttacaggcggacaatttaatcctgaacaccacaaaatagcgccgacgatt
ctagatcaagtgaaggatgactctccagtaatgcaggaggagattttcgggccgattctt
ccgctgtttacatacggcgatatcgatgaagtcatcgagaaagtccaatcacgcccaaag
ccgctcgctctttatgtcttcacaacaaacaaaggaatcgagcgaactgttttagagaat
ctgtcatttggcggcggctgtgtcaatgatacgttaatgcacgtcgcgacaccgtatttg
ccattcggcggcgtcggagaaagcggcatcggcagctatcacggatttaacagctttaac
gcatttacgcacaaaaaaagcgtcgtcaaacaaacgaaccgcttcgacctcgctttccgt
tatccttcttccaaaaacgggctgcgaatgatccggaaaatacttaaataa

DBGET integrated database retrieval system