KEGG   Bacillus amyloliquefaciens IT-45: KSO_014025Help
Entry
KSO_014025        CDS       T02462                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bami  Bacillus amyloliquefaciens IT-45
Brite
KEGG Orthology (KO) [BR:bami00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bami03009]
    KSO_014025
Enzymes [BR:bami01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     KSO_014025
Ribosome biogenesis [BR:bami03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KSO_014025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGF28294
Position
complement(2823199..2824092)
Genome map
AA seq 297 aa AA seqDB search
MDNFFIQKNMTARDAGMTVKEYTAQLGISKRLLADIKFGGGDLLVNGEHVTVRAVLAEGD
VLKIEFPKEHVSETLLPEPVPLDILYEDDHVLVVNKQPYVSSIPSREHPSESIANGVISH
YRKSGVQSTVHLVTRLDRDTSGAMLIAKHRLSHSLLSAAQKKGLVSRRYLAVVHGIMLQK
EGTVDAPIGRKHDSIIERMVTPDGQRAVTHFQTEKAGHAFTLAALRLETGRTHQIRVHMS
YLGHPLVGDTLYGGKNEGIARQALHSERLSFVHPMTGETLVFHAPVPDDMKTLIEHM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttggacaacttttttatccaaaagaacatgactgcccgggatgccggcatgacggtaaaa
gaatatacggcgcagctcggcatttcaaagcggcttctcgctgacattaaattcggcggg
ggagacctgcttgtgaacggagagcatgtaaccgtccgcgccgtgttagcggagggagac
gtgcttaagattgaatttccgaaggagcatgtgagtgaaacgcttttgcctgagccggtt
ccgcttgatattctttatgaagatgaccatgtgcttgtggtcaataaacagccgtatgtc
tcctcaattccatcaagagaacacccgtcggaaagcatcgctaacggagtgatcagccac
taccgaaaaagcggcgtgcaatcaacggttcatcttgtcacccgccttgacagggataca
tcgggggcgatgctcatcgccaaacatcggctttcccattctcttttgtcggcagcacag
aaaaaggggcttgtcagcaggcgatatctcgctgtcgtacacgggatcatgctgcagaag
gaaggaacggtggacgcgcccatcggaagaaaacacgacagtattattgagcggatggta
acgccggatggacaacgagcggtgacgcattttcaaacggaaaaagcgggacatgcgttt
acgcttgcagccctgcggctggaaacggggcggacgcatcaaatccgggtgcacatgagc
tacctcggccatccgttagtcggtgatacactgtacggcggaaaaaatgagggaattgcc
cggcaggctcttcacagtgagcggctttcattcgtacaccccatgaccggagaaacgctc
gtttttcacgctccggtgcctgacgatatgaaaacattaattgaacacatgtaa

DBGET integrated database retrieval system