KEGG   Bacillus amyloliquefaciens IT-45: KSO_014590Help
Entry
KSO_014590        CDS       T02462                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00071  Fatty acid degradation
bami00072  Synthesis and degradation of ketone bodies
bami00280  Valine, leucine and isoleucine degradation
bami00310  Lysine degradation
bami00362  Benzoate degradation
bami00380  Tryptophan metabolism
bami00620  Pyruvate metabolism
bami00630  Glyoxylate and dicarboxylate metabolism
bami00640  Propanoate metabolism
bami00650  Butanoate metabolism
bami00900  Terpenoid backbone biosynthesis
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01120  Microbial metabolism in diverse environments
bami01130  Biosynthesis of antibiotics
bami01200  Carbon metabolism
bami01212  Fatty acid metabolism
bami02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KSO_014590
   00630 Glyoxylate and dicarboxylate metabolism
    KSO_014590
   00640 Propanoate metabolism
    KSO_014590
   00650 Butanoate metabolism
    KSO_014590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KSO_014590
   00072 Synthesis and degradation of ketone bodies
    KSO_014590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSO_014590
   00310 Lysine degradation
    KSO_014590
   00380 Tryptophan metabolism
    KSO_014590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KSO_014590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSO_014590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KSO_014590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bami04147]
    KSO_014590
Enzymes [BR:bami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KSO_014590
Exosome [BR:bami04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KSO_014590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGF28405
Position
2928655..2929746
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKAHEDGLYRREILPCHG
FAADENMLKKRNMEPLIARAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALITRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaagcggacgattttcgcccgggaaaacggcctgtta
aaagactgtctccccgaagatttggcagctccgctgatccgacatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaacctcgcc
cggctgtcagccttggccgccgggcttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggttccggattggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcacatacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcggccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgcacgaagacggcttgtaccgccgggaaattctcccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatcgcccgcgcc
aaacctgtctttcagtccggaggctctgtcaccgcggccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagccg
ggattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttatcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system