KEGG   Bacillus amyloliquefaciens IT-45: KSO_016445Help
Entry
KSO_016445        CDS       T02462                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain-containing protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KSO_016445
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KSO_016445
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KSO_016445
    1.1.1.-  
     KSO_016445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGF28776
Position
3316086..3317126
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGEPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcgaacctcatccgttaaca
aacgaaatggcgcccgtcacgatgggtcacgaattctcaggagaagtcgtggaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacatcagggagcctataaccttgatgaacaaatgggattcttaggcttagccgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcgcttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattaaaagcgggcgacaaggcggcagtttttggctgcggaccgatc
gggctgcttgtaattgaagccctgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgcacaaacggcggcgttgatgtttct
tatgaagtaacgggcgttcctgtcgttctccgccaggcgatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatctgggaaaaaggagcggaaattcatccgaacgatatc
gtcatcaaagaacggaccgtaaaagggattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaatcgtg
ctcgacgatctgattgaagaaggcttcggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system