KEGG   Bacillus velezensis UCMB5036: BAM5036_0166Help
Entry
BAM5036_0166      CDS       T02480                                 

Gene name
gutB
Definition
(GenBank) Zinc-containing alcohol dehydrogenase,long-chain (GutB1)
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:baml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAM5036_0166 (gutB)
Enzymes [BR:baml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BAM5036_0166 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BAM5036_0166 (gutB)
    1.1.1.-  
     BAM5036_0166 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NADH_4Fe-4S ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCP20232
Position
180575..181621
Genome map
AA seq 348 aa AA seqDB search
MKALVWTPNDKLEYQEVNEPQIRKSNDVKVKIFGTGICGTDLNVLKGKMNATHHMIMGHE
SVGAVVEIGPDVTNVKVGDRVVIDPTQFCGKCHYCRRGLTCYCETFEDWQLGIGAHGTFA
EYYVGEDRFMYRIPDSMEWERATLVEPLSCVLNVVDKASIQPEDSVLVLGSGPIGLLVQM
MVKKLARLTVATEIGSFRSEAASRISDYVYHPEALTVDEVKRINQGRKFDVIFDAIGNQL
DWAYPFIEKGGRIVPMGFDDTYEMTVRPYQLLSNGVTIVGTGEARQIMEAALACASDLPQ
LYDFITEKTELKNYEEAIDHLMGIDPVTKERKDISAIKTILVSDPELL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttggtctggactcctaatgataagcttgaatatcaagaggtgaacgagcct
caaattcggaaatccaatgatgtgaaagtgaaaattttcgggaccggtatctgcggaacg
gacttaaatgtgctgaaaggaaaaatgaatgcaacccatcatatgattatggggcatgaa
tcggtgggagcggtcgtggaaatcggaccggacgtgacaaatgtaaaagtcggagaccgc
gtcgtgatagatcctacgcagttttgcgggaaatgtcattattgccggagagggctgacg
tgttattgcgaaaccttcgaggattggcagctcggaatcggggcgcacggaacgtttgcg
gaatattacgtgggggaagacaggttcatgtacagaattccggattcaatggaatgggag
cgggccacattggttgagcctctctcctgtgtgctgaatgttgtggacaaggcttcgatt
cagccggaggactcggtcttggttttggggtcgggaccgatcggactgcttgtgcaaatg
atggtgaaaaaactggcgcgattgacggttgcgactgaaataggcagtttccgaagcgag
gcggcaagccggatatctgattatgtctaccaccctgaagcattaaccgtggatgaagtg
aaacggattaatcaaggaagaaaatttgatgtgatttttgacgcgatcggcaaccagctt
gattgggcttatccttttattgaaaagggaggcagaatcgtgccgatgggctttgatgat
acgtatgagatgacggtcaggccgtaccagctgctgtcaaacggcgtaacgattgtgggt
acaggtgaagcccgccagatcatggaagccgcgttagcatgcgcgtccgaccttccgcag
ctctatgattttattacggaaaagacggaactgaagaattatgaagaagccattgatcat
ctcatgggcatcgacccggtgacaaaagaaagaaaggatatcagcgcaataaaaacgatt
cttgtgtctgatccggaacttttataa

DBGET integrated database retrieval system