KEGG   Bacillus velezensis UCMB5036: BAM5036_2016Help
Entry
BAM5036_2016      CDS       T02480                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00230  Purine metabolism
baml00240  Pyrimidine metabolism
baml01100  Metabolic pathways
baml01110  Biosynthesis of secondary metabolites
baml01130  Biosynthesis of antibiotics
Module
baml_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
baml_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
baml_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:baml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BAM5036_2016 (ndk)
   00240 Pyrimidine metabolism
    BAM5036_2016 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:baml04131]
    BAM5036_2016 (ndk)
Enzymes [BR:baml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BAM5036_2016 (ndk)
Membrane trafficking [BR:baml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BAM5036_2016 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CCP22055
Position
complement(2180192..2180638)
Genome map
AA seq 148 aa AA seqDB search
MEKTFIMVKPDGVQRQLIGEILSRFERKGLQLAGAKLMQVSEQMAENHYAEHKGKPFFSE
LVEFITSGPVFAMVWEGENVVEITRQLIGKTNPKDALPGTIRGDYGMFVGKNIIHGSDSL
ESAEREIDIFFKQEELVPYQKLMADWVY
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacttttatcatggtaaaaccggacggcgtacagcgccagctaatcggagag
attttatccagatttgagcgtaagggcttacaattggcaggagccaagctaatgcaagtt
tcagaacagatggctgaaaaccattatgctgaacataaagggaagccgtttttcagcgag
cttgtggaattcattacatcaggacccgtatttgcaatggtatgggaaggggaaaatgta
gtagagatcacaagacagctgatcggaaaaacgaacccgaaagatgcactgccgggcacg
atccgcggtgactacggcatgtttgtcggcaaaaatatcattcacggttcagactcctta
gaaagcgctgagcgggaaattgacattttcttcaaacaggaagagcttgtaccgtatcaa
aaattaatggccgactgggtgtactaa

DBGET integrated database retrieval system