KEGG   Bacillus velezensis UCMB5036: BAM5036_2168Help
Entry
BAM5036_2168      CDS       T02480                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00071  Fatty acid degradation
baml00072  Synthesis and degradation of ketone bodies
baml00280  Valine, leucine and isoleucine degradation
baml00310  Lysine degradation
baml00362  Benzoate degradation
baml00380  Tryptophan metabolism
baml00620  Pyruvate metabolism
baml00630  Glyoxylate and dicarboxylate metabolism
baml00640  Propanoate metabolism
baml00650  Butanoate metabolism
baml00900  Terpenoid backbone biosynthesis
baml01100  Metabolic pathways
baml01110  Biosynthesis of secondary metabolites
baml01120  Microbial metabolism in diverse environments
baml01130  Biosynthesis of antibiotics
baml01200  Carbon metabolism
baml01212  Fatty acid metabolism
baml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAM5036_2168 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAM5036_2168 (mmgA)
   00640 Propanoate metabolism
    BAM5036_2168 (mmgA)
   00650 Butanoate metabolism
    BAM5036_2168 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAM5036_2168 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BAM5036_2168 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAM5036_2168 (mmgA)
   00310 Lysine degradation
    BAM5036_2168 (mmgA)
   00380 Tryptophan metabolism
    BAM5036_2168 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAM5036_2168 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAM5036_2168 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAM5036_2168 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baml04147]
    BAM5036_2168 (mmgA)
Enzymes [BR:baml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAM5036_2168 (mmgA)
Exosome [BR:baml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAM5036_2168 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: CCP22206
Position
complement(2374378..2375559)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagataccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaat
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagtcagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tccgtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctcgtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcgattgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggaggtttaggcatagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system