KEGG   Bacillus velezensis UCMB5036: BAM5036_3126Help
Entry
BAM5036_3126      CDS       T02480                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00340  Histidine metabolism
baml01100  Metabolic pathways
baml01110  Biosynthesis of secondary metabolites
baml01230  Biosynthesis of amino acids
Module
baml_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BAM5036_3126 (hisD)
Enzymes [BR:baml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BAM5036_3126 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Peptidase_M3
Motif
Other DBs
NCBI-ProteinID: CCP23141
Position
complement(3306844..3308157)
Genome map
AA seq 437 aa AA seqDB search
MKITAVKRSERFSLKRSIDSGTEEQRKTVRGIIEDVRQNGDKAVLAYTKTFDGISLNQMA
VSAEEVTEAYRLLDDQLLEVIRQAIANIKEYHERQLQSSWFYHRKDGSMLGQKITALDSA
GVYVPGGTAAYPSSVLMNVIPALAAGVERIVLVSPPGKDGRLSPGVLAAASELGIKEIYK
AGGAQAIAALAYGTETIQPVDKITGPGNIFVALAKREVFGVVDIDMIAGPSEIVVLADDT
AVPKEVAADLLSQAEHDTLSSSVLVTDSRKLAEAVSDEVNKQLQTLPRKEIAEASIRDHG
RIYITESMEDAVDTVNALAPEHLEIMTHSPEALLGSIRHAGAIFLGRYSAEPVGDYFAGP
NHVLPTNGTARFSSPLNVTDFQKKSSIISYSRKAFETHADSISAFARLEGLEAHARSIEA
RNGGMTDEKSGTRQNNK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaccgcagtaaaaagaagcgagcggttttcactgaagcgttccatcgacagc
ggaaccgaagagcagcggaaaaccgtcagggggattattgaagacgtcagacaaaacggt
gacaaagccgttttggcctatacaaaaacatttgacggcatcagcctgaaccaaatggcc
gtgagtgcagaggaagtcaccgaggcgtaccgtctgcttgatgatcagctgctggaagtg
atcagacaggcgattgccaatattaaagaatatcacgaacgccagctgcaatcctcgtgg
ttttaccatcgcaaagacggctcgatgctcgggcagaaaataacggcgctcgattccgca
ggcgtatacgtgccgggcgggacggccgcttatccgtcttccgttttaatgaatgtcatc
cccgctctcgctgcgggagtggaacggatcgttctcgtcagtcctccgggaaaagacggc
cgcctttcgccgggcgttctggcggcggcgtctgagctcggcataaaggaaatttacaaa
gcgggaggcgcgcaggcgattgccgcgctcgcttacggaaccgaaacgatacagcctgtt
gataagatcacgggccccggcaatatatttgtagcactcgcgaagcgcgaagtcttcggc
gttgtggatattgacatgattgccgggcccagtgaaatcgtggtcctggcagacgatacg
gcggtgcccaaagaagtagctgctgacctgctttcacaggcagaacacgatacgctcagc
tcaagcgtgcttgtcactgactcacggaagcttgccgaagccgtatcagatgaggtgaat
aaacagcttcagacgctgccgcgcaaagaaatcgccgaagcgtcgatcagggatcacgga
cgcatttacattacggaatcgatggaagatgcagtggacacggtgaatgcgctggcgccc
gagcatttagaaatcatgacgcattcgccggaggctttgcttggaagcatcagacacgcg
ggggcgattttcttagggcgatacagcgctgaaccggtcggcgattattttgccggaccg
aatcacgttttgccgacaaacggaacggcgcggttttcaagcccgttgaatgtaacagat
tttcaaaagaaatcgagcatcatctcatacagccggaaggcatttgaaacgcacgcggac
agcatttccgccttcgcgagactggaagggcttgaagcgcacgcaagatcgattgaagcg
agaaacggaggaatgaccgatgagaaaagcggaacgcgccagaacaacaaatga

DBGET integrated database retrieval system