KEGG   Bacillus velezensis UCMB5113: BASU_0992Help
Entry
BASU_0992         CDS       T02796                                 

Gene name
yhfS
Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00071  Fatty acid degradation
bamn00072  Synthesis and degradation of ketone bodies
bamn00280  Valine, leucine and isoleucine degradation
bamn00310  Lysine degradation
bamn00362  Benzoate degradation
bamn00380  Tryptophan metabolism
bamn00620  Pyruvate metabolism
bamn00630  Glyoxylate and dicarboxylate metabolism
bamn00640  Propanoate metabolism
bamn00650  Butanoate metabolism
bamn00900  Terpenoid backbone biosynthesis
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01120  Microbial metabolism in diverse environments
bamn01130  Biosynthesis of antibiotics
bamn01200  Carbon metabolism
bamn01212  Fatty acid metabolism
bamn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BASU_0992 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BASU_0992 (yhfS)
   00640 Propanoate metabolism
    BASU_0992 (yhfS)
   00650 Butanoate metabolism
    BASU_0992 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BASU_0992 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BASU_0992 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BASU_0992 (yhfS)
   00310 Lysine degradation
    BASU_0992 (yhfS)
   00380 Tryptophan metabolism
    BASU_0992 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BASU_0992 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BASU_0992 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BASU_0992 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamn04147]
    BASU_0992 (yhfS)
Enzymes [BR:bamn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BASU_0992 (yhfS)
Exosome [BR:bamn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BASU_0992 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDG25290
Position
complement(1020061..1021152)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKGCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKAHEDGLYRPEILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLL
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacaattttcgcccgggaaaacggcctgtta
aaaggctgtctcccagaagatttggcagctccgctgatccgccatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccgggcttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttgttaaagccggtgcg
gggagcacatacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcggccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgcacgaagacggcttgtaccgcccggaaattcttccctgtcacgga
ttcgccgccgacgaaaacatgctgaaaaagcggaacatggagcctctcatttcccgcgcc
aagcccgtttttcagtccggagggtctgtcaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagccg
ggattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaaacttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcta
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system